sbuild (Debian sbuild) 0.78.1 (09 February 2019) on gcc131.bak.milne.osuosl.org +==============================================================================+ | wise 2.4.1-23 (armel) Sat, 05 Jun 2021 17:26:25 +0000 | +==============================================================================+ Package: wise Version: 2.4.1-23 Source Version: 2.4.1-23 Distribution: unstable Machine Architecture: amd64 Host Architecture: armel Build Architecture: amd64 Build Profiles: cross nocheck Build Type: any I: NOTICE: Log filtering will replace 'var/run/schroot/mount/unstable-amd64-sbuild-8061ed78-5a4f-432b-83fc-325d707702dc' with '<>' I: NOTICE: Log filtering will replace 'build/wise-gZOqCi/resolver-x71wqS' with '<>' +------------------------------------------------------------------------------+ | Update chroot | +------------------------------------------------------------------------------+ Get:1 http://debian.oregonstate.edu/debian unstable InRelease [157 kB] Get:2 http://debian.oregonstate.edu/debian unstable/main Sources.diff/Index [63.6 kB] Get:3 http://debian.oregonstate.edu/debian unstable/main amd64 Packages.diff/Index [63.6 kB] Get:4 http://debian.oregonstate.edu/debian unstable/main Sources T-2021-06-05-1401.10-F-2021-06-05-0801.15.pdiff [4525 B] Get:4 http://debian.oregonstate.edu/debian unstable/main Sources T-2021-06-05-1401.10-F-2021-06-05-0801.15.pdiff [4525 B] Get:5 http://debian.oregonstate.edu/debian unstable/main amd64 Packages T-2021-06-05-1401.10-F-2021-06-05-0801.15.pdiff [3132 B] Get:5 http://debian.oregonstate.edu/debian unstable/main amd64 Packages T-2021-06-05-1401.10-F-2021-06-05-0801.15.pdiff [3132 B] Get:6 http://debian.oregonstate.edu/debian unstable/main armel Packages [8288 kB] Fetched 8580 kB in 4s (2145 kB/s) Reading package lists... Reading package lists... Building dependency tree... Reading state information... Calculating upgrade... 0 upgraded, 0 newly installed, 0 to remove and 0 not upgraded. +------------------------------------------------------------------------------+ | Fetch source files | +------------------------------------------------------------------------------+ Check APT --------- Checking available source versions... Download source files with APT ------------------------------ Reading package lists... NOTICE: 'wise' packaging is maintained in the 'Git' version control system at: https://salsa.debian.org/med-team/wise.git Please use: git clone https://salsa.debian.org/med-team/wise.git to retrieve the latest (possibly unreleased) updates to the package. Need to get 3440 kB of source archives. Get:1 http://debian.oregonstate.edu/debian unstable/main wise 2.4.1-23 (dsc) [2179 B] Get:2 http://debian.oregonstate.edu/debian unstable/main wise 2.4.1-23 (tar) [3410 kB] Get:3 http://debian.oregonstate.edu/debian unstable/main wise 2.4.1-23 (diff) [27.2 kB] Fetched 3440 kB in 0s (88.4 MB/s) Download complete and in download only mode I: NOTICE: Log filtering will replace 'build/wise-gZOqCi/wise-2.4.1' with '<>' I: NOTICE: Log filtering will replace 'build/wise-gZOqCi' with '<>' +------------------------------------------------------------------------------+ | Install package build dependencies | +------------------------------------------------------------------------------+ Setup apt archive ----------------- Merged Build-Depends: debhelper-compat (= 12), texlive-latex-base, texlive-extra-utils, hevea, docbook-to-man, libglib2.0-dev, libc-dev, libstdc++-dev, build-essential:amd64, fakeroot:amd64, crossbuild-essential-armel:amd64, libc-dev:armel, libstdc++-dev:armel Filtered Build-Depends: debhelper-compat (= 12), texlive-latex-base, texlive-extra-utils, hevea, docbook-to-man, libglib2.0-dev, libc-dev, libstdc++-dev, build-essential:amd64, fakeroot:amd64, crossbuild-essential-armel:amd64, libc-dev:armel, libstdc++-dev:armel dpkg-deb: building package 'sbuild-build-depends-main-dummy' in '/<>/apt_archive/sbuild-build-depends-main-dummy.deb'. Ign:1 copy:/<>/apt_archive ./ InRelease Get:2 copy:/<>/apt_archive ./ Release [957 B] Ign:3 copy:/<>/apt_archive ./ Release.gpg Get:4 copy:/<>/apt_archive ./ Sources [447 B] Get:5 copy:/<>/apt_archive ./ Packages [535 B] Fetched 1939 B in 0s (75.6 kB/s) Reading package lists... Reading package lists... Install main build dependencies (apt-based resolver) ---------------------------------------------------- Installing build dependencies Reading package lists... Building dependency tree... Reading state information... The following additional packages will be installed: autoconf automake autopoint autotools-dev binutils-arm-linux-gnueabi bsdextrautils build-essential cpp-10-arm-linux-gnueabi cpp-arm-linux-gnueabi cross-config crossbuild-essential-armel debhelper dh-autoreconf dh-strip-nondeterminism docbook docbook-to-man dpkg-cross dpkg-dev dwz file fontconfig-config fonts-dejavu-core fonts-lmodern fonts-urw-base35 g++ g++-10 g++-10-arm-linux-gnueabi g++-arm-linux-gnueabi gcc-10-arm-linux-gnueabi gcc-10-arm-linux-gnueabi-base gcc-10-base:armel gcc-10-cross-base gcc-9-base:armel gcc-arm-linux-gnueabi gettext gettext-base ghostscript groff-base hevea intltool-debian libarchive-zip-perl libasan5:armel libasan6-armel-cross libatomic1:armel libatomic1-armel-cross libavahi-client3 libavahi-common-data libavahi-common3 libblkid-dev:armel libblkid1:armel libbrotli1 libbsd0 libc6:armel libc6-armel-cross libc6-dev libc6-dev:armel libc6-dev-armel-cross libcairo2 libcom-err2:armel libconfig-auto-perl libconfig-inifiles-perl libcrypt-dev libcrypt-dev:armel libcrypt1:armel libcups2 libdatrie1 libdbus-1-3 libdebhelper-perl libdebian-dpkgcross-perl libdeflate0 libdpkg-perl libelf1 libexpat1 libffi-dev:armel libffi7:armel libfile-homedir-perl libfile-stripnondeterminism-perl libfile-which-perl libfontconfig1 libfontenc1 libfreetype6 libgcc-10-dev-armel-cross libgcc-9-dev:armel libgcc-s1:armel libgcc-s1-armel-cross libglib2.0-0 libglib2.0-0:armel libglib2.0-bin libglib2.0-data libglib2.0-dev:armel libglib2.0-dev-bin libgomp1:armel libgomp1-armel-cross libgraphite2-3 libgs9 libgs9-common libgssapi-krb5-2:armel libharfbuzz0b libice6 libicu67 libidn11 libijs-0.35 libio-string-perl libjbig0 libjbig2dec0 libjpeg62-turbo libjs-jquery libk5crypto3:armel libkeyutils1:armel libkpathsea6 libkrb5-3:armel libkrb5support0:armel liblcms2-2 liblocale-gettext-perl libmagic-mgc libmagic1 libmd0 libmime-charset-perl libmount-dev:armel libmount1:armel libmpdec3 libnetpbm10 libnsl-dev libnsl-dev:armel libnsl2:armel libopenjp2-7 libosp5 libpaper-utils libpaper1 libpcre16-3:armel libpcre2-16-0:armel libpcre2-32-0:armel libpcre2-8-0:armel libpcre2-dev:armel libpcre2-posix2:armel libpcre3:armel libpcre3-dev:armel libpcre32-3:armel libpcrecpp0v5:armel libperl5.32 libpipeline1 libpixman-1-0 libpng16-16 libptexenc1 libpython3-stdlib libpython3.9-minimal libpython3.9-stdlib libreadline8 libselinux1:armel libselinux1-dev:armel libsepol1:armel libsepol1-dev:armel libsigsegv2 libsm6 libsombok3 libsqlite3-0 libssl1.1:armel libstdc++-10-dev libstdc++-10-dev-armel-cross libstdc++-9-dev:armel libstdc++6:armel libstdc++6-armel-cross libsub-override-perl libsynctex2 libteckit0 libtexlua53 libtexluajit2 libthai-data libthai0 libtiff5 libtirpc-dev libtirpc-dev:armel libtirpc3:armel libtool libubsan1:armel libubsan1-armel-cross libuchardet0 libunicode-linebreak-perl libuuid1:armel libwebp6 libx11-6 libx11-data libxau6 libxaw7 libxcb-render0 libxcb-shm0 libxcb1 libxdmcp6 libxext6 libxi6 libxml-libxml-perl libxml-namespacesupport-perl libxml-sax-base-perl libxml-sax-perl libxml-simple-perl libxml2 libxmu6 libxpm4 libxrender1 libxt6 libyaml-perl libzzip-0-13 linux-libc-dev:armel linux-libc-dev-armel-cross lmodern m4 man-db media-types netpbm opensp perl perl-modules-5.32 pkg-config po-debconf poppler-data python3 python3-distutils python3-lib2to3 python3-minimal python3.9 python3.9-minimal readline-common sensible-utils sgml-base sgml-data t1utils tex-common texlive-base texlive-binaries texlive-extra-utils texlive-latex-base texlive-luatex texlive-plain-generic ucf uuid-dev:armel x11-common xdg-utils xfonts-encodings xfonts-utils xml-core zlib1g:armel zlib1g-dev:armel Suggested packages: autoconf-archive gnu-standards autoconf-doc binutils-doc gcc-10-locales cpp-doc dh-make docbook-defguide docbook-dsssl docbook-xml psgml binutils-multiarch debian-keyring fonts-freefont-otf | fonts-freefont-ttf fonts-texgyre g++-multilib g++-10-multilib gcc-10-doc manpages-dev flex bison gdb-arm-linux-gnueabi gcc-doc gettext-doc libasprintf-dev libgettextpo-dev ghostscript-x groff hevea-doc texlive-latex-extra glibc-doc:armel libc-l10n:armel locales:armel glibc-doc manpages-dev:armel cups-common gnupg git bzr libgirepository1.0-dev:armel libglib2.0-doc:armel libgdk-pixbuf2.0-bin | libgdk-pixbuf2.0-dev libxml2-utils krb5-doc:armel krb5-user:armel liblcms2-utils libencode-hanextra-perl libpod2-base-perl libstdc++-10-doc libstdc++-9-doc:armel libtool-doc gfortran | fortran95-compiler gcj-jdk libyaml-shell-perl m4-doc apparmor less www-browser doc-base perl-doc libterm-readline-gnu-perl | libterm-readline-perl-perl libtap-harness-archive-perl libmail-box-perl poppler-utils fonts-japanese-mincho | fonts-ipafont-mincho fonts-japanese-gothic | fonts-ipafont-gothic fonts-arphic-ukai fonts-arphic-uming fonts-nanum python3-doc python3-tk python3-venv python3.9-venv python3.9-doc binfmt-support readline-doc sgml-base-doc perlsgml w3-recs perl-tk xpdf | pdf-viewer xzdec chktex default-jre-headless dvidvi dvipng fragmaster lacheck latexdiff latexmk purifyeps xindy texlive-latex-base-doc Recommended packages: gnupg libalgorithm-merge-perl curl | wget | lynx libidn2-0:armel libnss-nis:armel libnss-nisplus:armel dbus libfile-fcntllock-perl libarchive-cpio-perl shared-mime-info xdg-user-dirs shared-mime-info:armel xdg-user-dirs:armel fonts-droid-fallback javascript-common krb5-locales:armel ca-certificates libltdl-dev uuid-runtime:armel libwww-perl libxml-sax-expat-perl libyaml-libyaml-perl | libyaml-syck-perl netbase libmail-sendmail-perl dvisvgm liblog-log4perl-perl libyaml-tiny-perl ruby | ruby-interpreter texlive-latex-recommended libfile-mimeinfo-perl libnet-dbus-perl libx11-protocol-perl x11-utils x11-xserver-utils The following NEW packages will be installed: autoconf automake autopoint autotools-dev binutils-arm-linux-gnueabi bsdextrautils build-essential cpp-10-arm-linux-gnueabi cpp-arm-linux-gnueabi cross-config crossbuild-essential-armel debhelper dh-autoreconf dh-strip-nondeterminism docbook docbook-to-man dpkg-cross dpkg-dev dwz file fontconfig-config fonts-dejavu-core fonts-lmodern fonts-urw-base35 g++ g++-10 g++-10-arm-linux-gnueabi g++-arm-linux-gnueabi gcc-10-arm-linux-gnueabi gcc-10-arm-linux-gnueabi-base gcc-10-base:armel gcc-10-cross-base gcc-9-base:armel gcc-arm-linux-gnueabi gettext gettext-base ghostscript groff-base hevea intltool-debian libarchive-zip-perl libasan5:armel libasan6-armel-cross libatomic1:armel libatomic1-armel-cross libavahi-client3 libavahi-common-data libavahi-common3 libblkid-dev:armel libblkid1:armel libbrotli1 libbsd0 libc6:armel libc6-armel-cross libc6-dev libc6-dev:armel libc6-dev-armel-cross libcairo2 libcom-err2:armel libconfig-auto-perl libconfig-inifiles-perl libcrypt-dev libcrypt-dev:armel libcrypt1:armel libcups2 libdatrie1 libdbus-1-3 libdebhelper-perl libdebian-dpkgcross-perl libdeflate0 libdpkg-perl libelf1 libexpat1 libffi-dev:armel libffi7:armel libfile-homedir-perl libfile-stripnondeterminism-perl libfile-which-perl libfontconfig1 libfontenc1 libfreetype6 libgcc-10-dev-armel-cross libgcc-9-dev:armel libgcc-s1:armel libgcc-s1-armel-cross libglib2.0-0 libglib2.0-0:armel libglib2.0-bin libglib2.0-data libglib2.0-dev:armel libglib2.0-dev-bin libgomp1:armel libgomp1-armel-cross libgraphite2-3 libgs9 libgs9-common libgssapi-krb5-2:armel libharfbuzz0b libice6 libicu67 libidn11 libijs-0.35 libio-string-perl libjbig0 libjbig2dec0 libjpeg62-turbo libjs-jquery libk5crypto3:armel libkeyutils1:armel libkpathsea6 libkrb5-3:armel libkrb5support0:armel liblcms2-2 liblocale-gettext-perl libmagic-mgc libmagic1 libmd0 libmime-charset-perl libmount-dev:armel libmount1:armel libmpdec3 libnetpbm10 libnsl-dev libnsl-dev:armel libnsl2:armel libopenjp2-7 libosp5 libpaper-utils libpaper1 libpcre16-3:armel libpcre2-16-0:armel libpcre2-32-0:armel libpcre2-8-0:armel libpcre2-dev:armel libpcre2-posix2:armel libpcre3:armel libpcre3-dev:armel libpcre32-3:armel libpcrecpp0v5:armel libperl5.32 libpipeline1 libpixman-1-0 libpng16-16 libptexenc1 libpython3-stdlib libpython3.9-minimal libpython3.9-stdlib libreadline8 libselinux1:armel libselinux1-dev:armel libsepol1:armel libsepol1-dev:armel libsigsegv2 libsm6 libsombok3 libsqlite3-0 libssl1.1:armel libstdc++-10-dev libstdc++-10-dev-armel-cross libstdc++-9-dev:armel libstdc++6:armel libstdc++6-armel-cross libsub-override-perl libsynctex2 libteckit0 libtexlua53 libtexluajit2 libthai-data libthai0 libtiff5 libtirpc-dev libtirpc-dev:armel libtirpc3:armel libtool libubsan1:armel libubsan1-armel-cross libuchardet0 libunicode-linebreak-perl libuuid1:armel libwebp6 libx11-6 libx11-data libxau6 libxaw7 libxcb-render0 libxcb-shm0 libxcb1 libxdmcp6 libxext6 libxi6 libxml-libxml-perl libxml-namespacesupport-perl libxml-sax-base-perl libxml-sax-perl libxml-simple-perl libxml2 libxmu6 libxpm4 libxrender1 libxt6 libyaml-perl libzzip-0-13 linux-libc-dev:armel linux-libc-dev-armel-cross lmodern m4 man-db media-types netpbm opensp perl perl-modules-5.32 pkg-config po-debconf poppler-data python3 python3-distutils python3-lib2to3 python3-minimal python3.9 python3.9-minimal readline-common sbuild-build-depends-main-dummy:armel sensible-utils sgml-base sgml-data t1utils tex-common texlive-base texlive-binaries texlive-extra-utils texlive-latex-base texlive-luatex texlive-plain-generic ucf uuid-dev:armel x11-common xdg-utils xfonts-encodings xfonts-utils xml-core zlib1g:armel zlib1g-dev:armel 0 upgraded, 243 newly installed, 0 to remove and 0 not upgraded. Need to get 402 MB of archives. After this operation, 1396 MB of additional disk space will be used. Get:1 copy:/<>/apt_archive ./ sbuild-build-depends-main-dummy 0.invalid.0 [964 B] Get:2 http://debian.oregonstate.edu/debian unstable/main amd64 bsdextrautils amd64 2.36.1-7 [145 kB] Get:3 http://debian.oregonstate.edu/debian unstable/main amd64 libuchardet0 amd64 0.0.7-1 [67.8 kB] Get:4 http://debian.oregonstate.edu/debian unstable/main amd64 groff-base amd64 1.22.4-6 [936 kB] Get:5 http://debian.oregonstate.edu/debian unstable/main amd64 libpipeline1 amd64 1.5.3-1 [34.3 kB] Get:6 http://debian.oregonstate.edu/debian unstable/main amd64 man-db amd64 2.9.4-2 [1354 kB] Get:7 http://debian.oregonstate.edu/debian unstable/main amd64 perl-modules-5.32 all 5.32.1-4 [2823 kB] Get:8 http://debian.oregonstate.edu/debian unstable/main amd64 libperl5.32 amd64 5.32.1-4 [4117 kB] Get:9 http://debian.oregonstate.edu/debian unstable/main amd64 perl amd64 5.32.1-4 [293 kB] Get:10 http://debian.oregonstate.edu/debian unstable/main amd64 liblocale-gettext-perl amd64 1.07-4+b1 [19.0 kB] Get:11 http://debian.oregonstate.edu/debian unstable/main amd64 poppler-data all 0.4.10-1 [1602 kB] Get:12 http://debian.oregonstate.edu/debian unstable/main amd64 libpython3.9-minimal amd64 3.9.2-1 [801 kB] Get:13 http://debian.oregonstate.edu/debian unstable/main amd64 libexpat1 amd64 2.2.10-2 [96.9 kB] Get:14 http://debian.oregonstate.edu/debian unstable/main amd64 python3.9-minimal amd64 3.9.2-1 [1955 kB] Get:15 http://debian.oregonstate.edu/debian unstable/main amd64 python3-minimal amd64 3.9.2-3 [38.2 kB] Get:16 http://debian.oregonstate.edu/debian unstable/main amd64 media-types all 4.0.0 [30.3 kB] Get:17 http://debian.oregonstate.edu/debian unstable/main amd64 libmpdec3 amd64 2.5.1-2 [87.8 kB] Get:18 http://debian.oregonstate.edu/debian unstable/main amd64 readline-common all 8.1-2 [73.8 kB] Get:19 http://debian.oregonstate.edu/debian unstable/main amd64 libreadline8 amd64 8.1-2 [168 kB] Get:20 http://debian.oregonstate.edu/debian unstable/main amd64 libsqlite3-0 amd64 3.34.1-3 [797 kB] Get:21 http://debian.oregonstate.edu/debian unstable/main amd64 libpython3.9-stdlib amd64 3.9.2-1 [1684 kB] Get:22 http://debian.oregonstate.edu/debian unstable/main amd64 python3.9 amd64 3.9.2-1 [466 kB] Get:23 http://debian.oregonstate.edu/debian unstable/main amd64 libpython3-stdlib amd64 3.9.2-3 [21.4 kB] Get:24 http://debian.oregonstate.edu/debian unstable/main amd64 python3 amd64 3.9.2-3 [37.9 kB] Get:25 http://debian.oregonstate.edu/debian unstable/main amd64 sgml-base all 1.30 [15.1 kB] Get:26 http://debian.oregonstate.edu/debian unstable/main amd64 sensible-utils all 0.0.14 [14.8 kB] Get:27 http://debian.oregonstate.edu/debian unstable/main amd64 ucf all 3.0043 [74.0 kB] Get:28 http://debian.oregonstate.edu/debian unstable/main amd64 tex-common all 6.16 [53.7 kB] Get:29 http://debian.oregonstate.edu/debian unstable/main armel gcc-10-base armel 10.2.1-6 [201 kB] Get:30 http://debian.oregonstate.edu/debian unstable/main armel gcc-9-base armel 9.4.0-1 [199 kB] Get:31 http://debian.oregonstate.edu/debian unstable/main amd64 libmagic-mgc amd64 1:5.39-3 [273 kB] Get:32 http://debian.oregonstate.edu/debian unstable/main amd64 libmagic1 amd64 1:5.39-3 [126 kB] Get:33 http://debian.oregonstate.edu/debian unstable/main amd64 file amd64 1:5.39-3 [69.1 kB] Get:34 http://debian.oregonstate.edu/debian unstable/main amd64 gettext-base amd64 0.21-4 [175 kB] Get:35 http://debian.oregonstate.edu/debian unstable/main amd64 libsigsegv2 amd64 2.13-1 [34.8 kB] Get:36 http://debian.oregonstate.edu/debian unstable/main amd64 m4 amd64 1.4.18-5 [204 kB] Get:37 http://debian.oregonstate.edu/debian unstable/main amd64 autoconf all 2.69-14 [313 kB] Get:38 http://debian.oregonstate.edu/debian unstable/main amd64 autotools-dev all 20180224.1+nmu1 [77.1 kB] Get:39 http://debian.oregonstate.edu/debian unstable/main amd64 automake all 1:1.16.3-2 [814 kB] Get:40 http://debian.oregonstate.edu/debian unstable/main amd64 autopoint all 0.21-4 [510 kB] Get:41 http://debian.oregonstate.edu/debian unstable/main amd64 binutils-arm-linux-gnueabi amd64 2.35.2-2 [2779 kB] Get:42 http://debian.oregonstate.edu/debian unstable/main amd64 libcrypt-dev amd64 1:4.4.18-4 [104 kB] Get:43 http://debian.oregonstate.edu/debian unstable/main amd64 libtirpc-dev amd64 1.3.1-1 [190 kB] Get:44 http://debian.oregonstate.edu/debian unstable/main amd64 libnsl-dev amd64 1.3.0-2 [66.4 kB] Get:45 http://debian.oregonstate.edu/debian unstable/main amd64 libc6-dev amd64 2.31-12 [2346 kB] Get:46 http://debian.oregonstate.edu/debian unstable/main amd64 libstdc++-10-dev amd64 10.2.1-6 [1741 kB] Get:47 http://debian.oregonstate.edu/debian unstable/main amd64 g++-10 amd64 10.2.1-6 [9380 kB] Get:48 http://debian.oregonstate.edu/debian unstable/main amd64 g++ amd64 4:10.2.1-1 [1644 B] Get:49 http://debian.oregonstate.edu/debian unstable/main amd64 libdpkg-perl all 1.20.9 [1537 kB] Get:50 http://debian.oregonstate.edu/debian unstable/main amd64 dpkg-dev all 1.20.9 [2153 kB] Get:51 http://debian.oregonstate.edu/debian unstable/main amd64 build-essential amd64 12.9 [7704 B] Get:52 http://debian.oregonstate.edu/debian unstable/main amd64 gcc-10-arm-linux-gnueabi-base amd64 10.2.1-6cross1 [202 kB] Get:53 http://debian.oregonstate.edu/debian unstable/main amd64 cpp-10-arm-linux-gnueabi amd64 10.2.1-6cross1 [44.1 MB] Get:54 http://debian.oregonstate.edu/debian unstable/main amd64 cpp-arm-linux-gnueabi amd64 4:10.2.1-1 [16.8 kB] Get:55 http://debian.oregonstate.edu/debian unstable/main amd64 cross-config all 2.6.18+nmu1 [31.5 kB] Get:56 http://debian.oregonstate.edu/debian unstable/main amd64 gcc-10-cross-base all 10.2.1-6cross1 [197 kB] Get:57 http://debian.oregonstate.edu/debian unstable/main amd64 libc6-armel-cross all 2.31-9cross4 [1114 kB] Get:58 http://debian.oregonstate.edu/debian unstable/main amd64 libgcc-s1-armel-cross all 10.2.1-6cross1 [38.3 kB] Get:59 http://debian.oregonstate.edu/debian unstable/main amd64 libgomp1-armel-cross all 10.2.1-6cross1 [85.3 kB] Get:60 http://debian.oregonstate.edu/debian unstable/main amd64 libatomic1-armel-cross all 10.2.1-6cross1 [8832 B] Get:61 http://debian.oregonstate.edu/debian unstable/main amd64 libasan6-armel-cross all 10.2.1-6cross1 [1979 kB] Get:62 http://debian.oregonstate.edu/debian unstable/main amd64 libstdc++6-armel-cross all 10.2.1-6cross1 [370 kB] Get:63 http://debian.oregonstate.edu/debian unstable/main amd64 libubsan1-armel-cross all 10.2.1-6cross1 [746 kB] Get:64 http://debian.oregonstate.edu/debian unstable/main amd64 libgcc-10-dev-armel-cross all 10.2.1-6cross1 [688 kB] Get:65 http://debian.oregonstate.edu/debian unstable/main amd64 gcc-10-arm-linux-gnueabi amd64 10.2.1-6cross1 [50.4 MB] Get:66 http://debian.oregonstate.edu/debian unstable/main amd64 gcc-arm-linux-gnueabi amd64 4:10.2.1-1 [1460 B] Get:67 http://debian.oregonstate.edu/debian unstable/main amd64 linux-libc-dev-armel-cross all 5.10.13-1cross4 [1365 kB] Get:68 http://debian.oregonstate.edu/debian unstable/main amd64 libc6-dev-armel-cross all 2.31-9cross4 [1884 kB] Get:69 http://debian.oregonstate.edu/debian unstable/main amd64 libstdc++-10-dev-armel-cross all 10.2.1-6cross1 [1753 kB] Get:70 http://debian.oregonstate.edu/debian unstable/main amd64 g++-10-arm-linux-gnueabi amd64 10.2.1-6cross1 [47.1 MB] Get:71 http://debian.oregonstate.edu/debian unstable/main amd64 g++-arm-linux-gnueabi amd64 4:10.2.1-1 [1176 B] Get:72 http://debian.oregonstate.edu/debian unstable/main amd64 libconfig-inifiles-perl all 3.000003-1 [52.1 kB] Get:73 http://debian.oregonstate.edu/debian unstable/main amd64 libio-string-perl all 1.08-3.1 [11.8 kB] Get:74 http://debian.oregonstate.edu/debian unstable/main amd64 libicu67 amd64 67.1-6 [8625 kB] Get:75 http://debian.oregonstate.edu/debian unstable/main amd64 libxml2 amd64 2.9.10+dfsg-6.7 [693 kB] Get:76 http://debian.oregonstate.edu/debian unstable/main amd64 libxml-namespacesupport-perl all 1.12-1.1 [14.9 kB] Get:77 http://debian.oregonstate.edu/debian unstable/main amd64 libxml-sax-base-perl all 1.09-1.1 [20.7 kB] Get:78 http://debian.oregonstate.edu/debian unstable/main amd64 libxml-sax-perl all 1.02+dfsg-1 [59.0 kB] Get:79 http://debian.oregonstate.edu/debian unstable/main amd64 libxml-libxml-perl amd64 2.0134+dfsg-2+b1 [337 kB] Get:80 http://debian.oregonstate.edu/debian unstable/main amd64 libxml-simple-perl all 2.25-1 [72.0 kB] Get:81 http://debian.oregonstate.edu/debian unstable/main amd64 libyaml-perl all 1.30-1 [67.7 kB] Get:82 http://debian.oregonstate.edu/debian unstable/main amd64 libconfig-auto-perl all 0.44-1.1 [19.0 kB] Get:83 http://debian.oregonstate.edu/debian unstable/main amd64 libfile-which-perl all 1.23-1 [16.6 kB] Get:84 http://debian.oregonstate.edu/debian unstable/main amd64 libfile-homedir-perl all 1.006-1 [43.8 kB] Get:85 http://debian.oregonstate.edu/debian unstable/main amd64 libdebian-dpkgcross-perl all 2.6.18+nmu1 [30.5 kB] Get:86 http://debian.oregonstate.edu/debian unstable/main amd64 dpkg-cross all 2.6.18+nmu1 [41.6 kB] Get:87 http://debian.oregonstate.edu/debian unstable/main amd64 crossbuild-essential-armel all 12.9 [6704 B] Get:88 http://debian.oregonstate.edu/debian unstable/main amd64 libdebhelper-perl all 13.3.4 [189 kB] Get:89 http://debian.oregonstate.edu/debian unstable/main amd64 libtool all 2.4.6-15 [513 kB] Get:90 http://debian.oregonstate.edu/debian unstable/main amd64 dh-autoreconf all 20 [17.1 kB] Get:91 http://debian.oregonstate.edu/debian unstable/main amd64 libarchive-zip-perl all 1.68-1 [104 kB] Get:92 http://debian.oregonstate.edu/debian unstable/main amd64 libsub-override-perl all 0.09-2 [10.2 kB] Get:93 http://debian.oregonstate.edu/debian unstable/main amd64 libfile-stripnondeterminism-perl all 1.12.0-1 [26.3 kB] Get:94 http://debian.oregonstate.edu/debian unstable/main amd64 dh-strip-nondeterminism all 1.12.0-1 [15.4 kB] Get:95 http://debian.oregonstate.edu/debian unstable/main amd64 libelf1 amd64 0.183-3 [165 kB] Get:96 http://debian.oregonstate.edu/debian unstable/main amd64 dwz amd64 0.14-1 [98.3 kB] Get:97 http://debian.oregonstate.edu/debian unstable/main amd64 gettext amd64 0.21-4 [1311 kB] Get:98 http://debian.oregonstate.edu/debian unstable/main amd64 intltool-debian all 0.35.0+20060710.5 [26.8 kB] Get:99 http://debian.oregonstate.edu/debian unstable/main amd64 po-debconf all 1.0.21+nmu1 [248 kB] Get:100 http://debian.oregonstate.edu/debian unstable/main amd64 debhelper all 13.3.4 [1049 kB] Get:101 http://debian.oregonstate.edu/debian unstable/main amd64 xml-core all 0.18+nmu1 [23.8 kB] Get:102 http://debian.oregonstate.edu/debian unstable/main amd64 sgml-data all 2.0.11+nmu1 [179 kB] Get:103 http://debian.oregonstate.edu/debian unstable/main amd64 docbook all 4.5-6 [129 kB] Get:104 http://debian.oregonstate.edu/debian unstable/main amd64 libosp5 amd64 1.5.2-13+b2 [934 kB] Get:105 http://debian.oregonstate.edu/debian unstable/main amd64 opensp amd64 1.5.2-13+b2 [421 kB] Get:106 http://debian.oregonstate.edu/debian unstable/main amd64 docbook-to-man amd64 1:2.0.0-45 [77.4 kB] Get:107 http://debian.oregonstate.edu/debian unstable/main amd64 fonts-dejavu-core all 2.37-2 [1069 kB] Get:108 http://debian.oregonstate.edu/debian unstable/main amd64 fonts-urw-base35 all 20200910-1 [6367 kB] Get:109 http://debian.oregonstate.edu/debian unstable/main amd64 fontconfig-config all 2.13.1-4.2 [281 kB] Get:110 http://debian.oregonstate.edu/debian unstable/main amd64 fonts-lmodern all 2.004.5-6.1 [4540 kB] Get:111 http://debian.oregonstate.edu/debian unstable/main amd64 libgs9-common all 9.53.3~dfsg-7 [734 kB] Get:112 http://debian.oregonstate.edu/debian unstable/main amd64 libavahi-common-data amd64 0.8-5 [124 kB] Get:113 http://debian.oregonstate.edu/debian unstable/main amd64 libavahi-common3 amd64 0.8-5 [58.4 kB] Get:114 http://debian.oregonstate.edu/debian unstable/main amd64 libdbus-1-3 amd64 1.12.20-2 [219 kB] Get:115 http://debian.oregonstate.edu/debian unstable/main amd64 libavahi-client3 amd64 0.8-5 [62.1 kB] Get:116 http://debian.oregonstate.edu/debian unstable/main amd64 libcups2 amd64 2.3.3op2-3+deb11u1 [350 kB] Get:117 http://debian.oregonstate.edu/debian unstable/main amd64 libbrotli1 amd64 1.0.9-2+b2 [279 kB] Get:118 http://debian.oregonstate.edu/debian unstable/main amd64 libpng16-16 amd64 1.6.37-3 [294 kB] Get:119 http://debian.oregonstate.edu/debian unstable/main amd64 libfreetype6 amd64 2.10.4+dfsg-1 [418 kB] Get:120 http://debian.oregonstate.edu/debian unstable/main amd64 libfontconfig1 amd64 2.13.1-4.2 [347 kB] Get:121 http://debian.oregonstate.edu/debian unstable/main amd64 libidn11 amd64 1.33-3 [116 kB] Get:122 http://debian.oregonstate.edu/debian unstable/main amd64 libijs-0.35 amd64 0.35-15 [16.4 kB] Get:123 http://debian.oregonstate.edu/debian unstable/main amd64 libjbig2dec0 amd64 0.19-3 [67.2 kB] Get:124 http://debian.oregonstate.edu/debian unstable/main amd64 libjpeg62-turbo amd64 1:2.0.6-4 [151 kB] Get:125 http://debian.oregonstate.edu/debian unstable/main amd64 liblcms2-2 amd64 2.12~rc1-2 [150 kB] Get:126 http://debian.oregonstate.edu/debian unstable/main amd64 libopenjp2-7 amd64 2.4.0-3 [172 kB] Get:127 http://debian.oregonstate.edu/debian unstable/main amd64 libpaper1 amd64 1.1.28+b1 [21.6 kB] Get:128 http://debian.oregonstate.edu/debian unstable/main amd64 libdeflate0 amd64 1.7-1 [53.1 kB] Get:129 http://debian.oregonstate.edu/debian unstable/main amd64 libjbig0 amd64 2.1-3.1+b2 [31.0 kB] Get:130 http://debian.oregonstate.edu/debian unstable/main amd64 libwebp6 amd64 0.6.1-2+b1 [261 kB] Get:131 http://debian.oregonstate.edu/debian unstable/main amd64 libtiff5 amd64 4.2.0-1 [289 kB] Get:132 http://debian.oregonstate.edu/debian unstable/main amd64 libgs9 amd64 9.53.3~dfsg-7 [2244 kB] Get:133 http://debian.oregonstate.edu/debian unstable/main amd64 ghostscript amd64 9.53.3~dfsg-7 [97.8 kB] Get:134 http://debian.oregonstate.edu/debian unstable/main amd64 libnetpbm10 amd64 2:10.0-15.4 [86.2 kB] Get:135 http://debian.oregonstate.edu/debian unstable/main amd64 netpbm amd64 2:10.0-15.4 [1011 kB] Get:136 http://debian.oregonstate.edu/debian unstable/main amd64 libpaper-utils amd64 1.1.28+b1 [18.3 kB] Get:137 http://debian.oregonstate.edu/debian unstable/main amd64 libkpathsea6 amd64 2020.20200327.54578-7 [172 kB] Get:138 http://debian.oregonstate.edu/debian unstable/main amd64 libptexenc1 amd64 2020.20200327.54578-7 [64.5 kB] Get:139 http://debian.oregonstate.edu/debian unstable/main amd64 libsynctex2 amd64 2020.20200327.54578-7 [83.2 kB] Get:140 http://debian.oregonstate.edu/debian unstable/main amd64 libtexlua53 amd64 2020.20200327.54578-7 [132 kB] Get:141 http://debian.oregonstate.edu/debian unstable/main amd64 libtexluajit2 amd64 2020.20200327.54578-7 [267 kB] Get:142 http://debian.oregonstate.edu/debian unstable/main amd64 t1utils amd64 1.41-4 [62.1 kB] Get:143 http://debian.oregonstate.edu/debian unstable/main amd64 libpixman-1-0 amd64 0.40.0-1 [543 kB] Get:144 http://debian.oregonstate.edu/debian unstable/main amd64 libxau6 amd64 1:1.0.9-1 [19.7 kB] Get:145 http://debian.oregonstate.edu/debian unstable/main amd64 libmd0 amd64 1.0.3-3 [28.0 kB] Get:146 http://debian.oregonstate.edu/debian unstable/main amd64 libbsd0 amd64 0.11.3-1 [108 kB] Get:147 http://debian.oregonstate.edu/debian unstable/main amd64 libxdmcp6 amd64 1:1.1.2-3 [26.3 kB] Get:148 http://debian.oregonstate.edu/debian unstable/main amd64 libxcb1 amd64 1.14-3 [140 kB] Get:149 http://debian.oregonstate.edu/debian unstable/main amd64 libx11-data all 2:1.7.1-1 [310 kB] Get:150 http://debian.oregonstate.edu/debian unstable/main amd64 libx11-6 amd64 2:1.7.1-1 [770 kB] Get:151 http://debian.oregonstate.edu/debian unstable/main amd64 libxcb-render0 amd64 1.14-3 [111 kB] Get:152 http://debian.oregonstate.edu/debian unstable/main amd64 libxcb-shm0 amd64 1.14-3 [101 kB] Get:153 http://debian.oregonstate.edu/debian unstable/main amd64 libxext6 amd64 2:1.3.3-1.1 [52.7 kB] Get:154 http://debian.oregonstate.edu/debian unstable/main amd64 libxrender1 amd64 1:0.9.10-1 [33.0 kB] Get:155 http://debian.oregonstate.edu/debian unstable/main amd64 libcairo2 amd64 1.16.0-5 [694 kB] Get:156 http://debian.oregonstate.edu/debian unstable/main amd64 libgraphite2-3 amd64 1.3.14-1 [81.2 kB] Get:157 http://debian.oregonstate.edu/debian unstable/main amd64 libglib2.0-0 amd64 2.66.8-1 [1370 kB] Get:158 http://debian.oregonstate.edu/debian unstable/main amd64 libharfbuzz0b amd64 2.7.4-1 [1471 kB] Get:159 http://debian.oregonstate.edu/debian unstable/main amd64 libteckit0 amd64 2.5.10+ds1-3 [329 kB] Get:160 http://debian.oregonstate.edu/debian unstable/main amd64 x11-common all 1:7.7+22 [252 kB] Get:161 http://debian.oregonstate.edu/debian unstable/main amd64 libice6 amd64 2:1.0.10-1 [58.5 kB] Get:162 http://debian.oregonstate.edu/debian unstable/main amd64 libsm6 amd64 2:1.2.3-1 [35.1 kB] Get:163 http://debian.oregonstate.edu/debian unstable/main amd64 libxt6 amd64 1:1.2.0-1 [189 kB] Get:164 http://debian.oregonstate.edu/debian unstable/main amd64 libxmu6 amd64 2:1.1.2-2+b3 [60.8 kB] Get:165 http://debian.oregonstate.edu/debian unstable/main amd64 libxpm4 amd64 1:3.5.12-1 [49.1 kB] Get:166 http://debian.oregonstate.edu/debian unstable/main amd64 libxaw7 amd64 2:1.0.13-1.1 [202 kB] Get:167 http://debian.oregonstate.edu/debian unstable/main amd64 libxi6 amd64 2:1.7.10-1 [83.4 kB] Get:168 http://debian.oregonstate.edu/debian unstable/main amd64 libzzip-0-13 amd64 0.13.62-3.3 [55.7 kB] Get:169 http://debian.oregonstate.edu/debian unstable/main amd64 texlive-binaries amd64 2020.20200327.54578-7 [10.1 MB] Get:170 http://debian.oregonstate.edu/debian unstable/main amd64 xdg-utils all 1.1.3-4.1 [75.5 kB] Get:171 http://debian.oregonstate.edu/debian unstable/main amd64 texlive-base all 2020.20210202-3 [20.8 MB] Get:172 http://debian.oregonstate.edu/debian unstable/main amd64 hevea amd64 2.34-2+b1 [1811 kB] Get:173 http://debian.oregonstate.edu/debian unstable/main armel libgcc-s1 armel 10.2.1-6 [38.4 kB] Get:174 http://debian.oregonstate.edu/debian unstable/main armel libcrypt1 armel 1:4.4.18-4 [97.0 kB] Get:175 http://debian.oregonstate.edu/debian unstable/main armel libc6 armel 2.31-12 [2341 kB] Get:176 http://debian.oregonstate.edu/debian unstable/main armel libasan5 armel 9.4.0-1 [2703 kB] Get:177 http://debian.oregonstate.edu/debian unstable/main armel libatomic1 armel 10.2.1-6 [9044 B] Get:178 http://debian.oregonstate.edu/debian unstable/main armel libblkid1 armel 2.36.1-7 [182 kB] Get:179 http://debian.oregonstate.edu/debian unstable/main armel linux-libc-dev armel 5.10.40-1 [1317 kB] Get:180 http://debian.oregonstate.edu/debian unstable/main armel libcrypt-dev armel 1:4.4.18-4 [115 kB] Get:181 http://debian.oregonstate.edu/debian unstable/main armel libcom-err2 armel 1.46.2-1 [73.3 kB] Get:182 http://debian.oregonstate.edu/debian unstable/main armel libkrb5support0 armel 1.18.3-5 [62.1 kB] Get:183 http://debian.oregonstate.edu/debian unstable/main armel libk5crypto3 armel 1.18.3-5 [108 kB] Get:184 http://debian.oregonstate.edu/debian unstable/main armel libkeyutils1 armel 1.6.1-2 [14.5 kB] Get:185 http://debian.oregonstate.edu/debian unstable/main armel libssl1.1 armel 1.1.1k-1 [1277 kB] Get:186 http://debian.oregonstate.edu/debian unstable/main armel libkrb5-3 armel 1.18.3-5 [315 kB] Get:187 http://debian.oregonstate.edu/debian unstable/main armel libgssapi-krb5-2 armel 1.18.3-5 [142 kB] Get:188 http://debian.oregonstate.edu/debian unstable/main armel libtirpc3 armel 1.3.1-1 [70.8 kB] Get:189 http://debian.oregonstate.edu/debian unstable/main armel libnsl2 armel 1.3.0-2 [33.0 kB] Get:190 http://debian.oregonstate.edu/debian unstable/main armel libtirpc-dev armel 1.3.1-1 [182 kB] Get:191 http://debian.oregonstate.edu/debian unstable/main armel libnsl-dev armel 1.3.0-2 [61.7 kB] Get:192 http://debian.oregonstate.edu/debian unstable/main armel libc6-dev armel 2.31-12 [1932 kB] Get:193 http://debian.oregonstate.edu/debian unstable/main armel libuuid1 armel 2.36.1-7 [82.5 kB] Get:194 http://debian.oregonstate.edu/debian unstable/main armel uuid-dev armel 2.36.1-7 [98.2 kB] Get:195 http://debian.oregonstate.edu/debian unstable/main armel libblkid-dev armel 2.36.1-7 [220 kB] Get:196 http://debian.oregonstate.edu/debian unstable/main amd64 libdatrie1 amd64 0.2.13-1 [42.7 kB] Get:197 http://debian.oregonstate.edu/debian unstable/main armel libffi7 armel 3.3-6 [19.9 kB] Get:198 http://debian.oregonstate.edu/debian unstable/main armel libffi-dev armel 3.3-6 [52.7 kB] Get:199 http://debian.oregonstate.edu/debian unstable/main amd64 libfontenc1 amd64 1:1.1.4-1 [24.3 kB] Get:200 http://debian.oregonstate.edu/debian unstable/main armel libgomp1 armel 10.2.1-6 [87.4 kB] Get:201 http://debian.oregonstate.edu/debian unstable/main armel libstdc++6 armel 10.2.1-6 [409 kB] Get:202 http://debian.oregonstate.edu/debian unstable/main armel libubsan1 armel 10.2.1-6 [746 kB] Get:203 http://debian.oregonstate.edu/debian unstable/main armel libgcc-9-dev armel 9.4.0-1 [641 kB] Get:204 http://debian.oregonstate.edu/debian unstable/main armel libpcre2-8-0 armel 10.36-2 [211 kB] Get:205 http://debian.oregonstate.edu/debian unstable/main armel libselinux1 armel 3.1-3 [80.9 kB] Get:206 http://debian.oregonstate.edu/debian unstable/main armel libmount1 armel 2.36.1-7 [193 kB] Get:207 http://debian.oregonstate.edu/debian unstable/main armel libpcre3 armel 2:8.39-13 [317 kB] Get:208 http://debian.oregonstate.edu/debian unstable/main armel zlib1g armel 1:1.2.11.dfsg-2 [84.7 kB] Get:209 http://debian.oregonstate.edu/debian unstable/main armel libglib2.0-0 armel 2.66.8-1 [1186 kB] Get:210 http://debian.oregonstate.edu/debian unstable/main amd64 libglib2.0-data all 2.66.8-1 [1164 kB] Get:211 http://debian.oregonstate.edu/debian unstable/main amd64 libglib2.0-bin amd64 2.66.8-1 [141 kB] Get:212 http://debian.oregonstate.edu/debian unstable/main amd64 python3-lib2to3 all 3.9.2-1 [77.8 kB] Get:213 http://debian.oregonstate.edu/debian unstable/main amd64 python3-distutils all 3.9.2-1 [143 kB] Get:214 http://debian.oregonstate.edu/debian unstable/main amd64 libglib2.0-dev-bin amd64 2.66.8-1 [179 kB] Get:215 http://debian.oregonstate.edu/debian unstable/main armel libsepol1 armel 3.1-1 [223 kB] Get:216 http://debian.oregonstate.edu/debian unstable/main armel libsepol1-dev armel 3.1-1 [307 kB] Get:217 http://debian.oregonstate.edu/debian unstable/main armel libpcre2-16-0 armel 10.36-2 [197 kB] Get:218 http://debian.oregonstate.edu/debian unstable/main armel libpcre2-32-0 armel 10.36-2 [187 kB] Get:219 http://debian.oregonstate.edu/debian unstable/main armel libpcre2-posix2 armel 10.36-2 [48.7 kB] Get:220 http://debian.oregonstate.edu/debian unstable/main armel libpcre2-dev armel 10.36-2 [631 kB] Get:221 http://debian.oregonstate.edu/debian unstable/main armel libselinux1-dev armel 3.1-3 [163 kB] Get:222 http://debian.oregonstate.edu/debian unstable/main armel libmount-dev armel 2.36.1-7 [77.8 kB] Get:223 http://debian.oregonstate.edu/debian unstable/main armel libpcre16-3 armel 2:8.39-13 [235 kB] Get:224 http://debian.oregonstate.edu/debian unstable/main armel libpcre32-3 armel 2:8.39-13 [226 kB] Get:225 http://debian.oregonstate.edu/debian unstable/main armel libpcrecpp0v5 armel 2:8.39-13 [150 kB] Get:226 http://debian.oregonstate.edu/debian unstable/main armel libpcre3-dev armel 2:8.39-13 [569 kB] Get:227 http://debian.oregonstate.edu/debian unstable/main amd64 pkg-config amd64 0.29.2-1 [65.1 kB] Get:228 http://debian.oregonstate.edu/debian unstable/main armel zlib1g-dev armel 1:1.2.11.dfsg-2 [185 kB] Get:229 http://debian.oregonstate.edu/debian unstable/main armel libglib2.0-dev armel 2.66.8-1 [1456 kB] Get:230 http://debian.oregonstate.edu/debian unstable/main amd64 libjs-jquery all 3.5.1+dfsg+~3.5.5-7 [315 kB] Get:231 http://debian.oregonstate.edu/debian unstable/main amd64 libmime-charset-perl all 1.012.2-1 [35.4 kB] Get:232 http://debian.oregonstate.edu/debian unstable/main amd64 libthai-data all 0.1.28-4 [171 kB] Get:233 http://debian.oregonstate.edu/debian unstable/main amd64 libthai0 amd64 0.1.28-4 [54.4 kB] Get:234 http://debian.oregonstate.edu/debian unstable/main amd64 libsombok3 amd64 2.4.0-2+b1 [31.4 kB] Get:235 http://debian.oregonstate.edu/debian unstable/main armel libstdc++-9-dev armel 9.4.0-1 [1754 kB] Get:236 http://debian.oregonstate.edu/debian unstable/main amd64 libunicode-linebreak-perl amd64 0.0.20190101-1+b3 [102 kB] Get:237 http://debian.oregonstate.edu/debian unstable/main amd64 xfonts-encodings all 1:1.0.4-2.1 [573 kB] Get:238 http://debian.oregonstate.edu/debian unstable/main amd64 xfonts-utils amd64 1:7.7+6 [93.0 kB] Get:239 http://debian.oregonstate.edu/debian unstable/main amd64 lmodern all 2.004.5-6.1 [9489 kB] Get:240 http://debian.oregonstate.edu/debian unstable/main amd64 texlive-latex-base all 2020.20210202-3 [1120 kB] Get:241 http://debian.oregonstate.edu/debian unstable/main amd64 texlive-luatex all 2020.20210202-3 [14.4 MB] Get:242 http://debian.oregonstate.edu/debian unstable/main amd64 texlive-plain-generic all 2020.20210202-3 [27.0 MB] Get:243 http://debian.oregonstate.edu/debian unstable/main amd64 texlive-extra-utils all 2020.20210202-3 [55.5 MB] debconf: delaying package configuration, since apt-utils is not installed Fetched 402 MB in 3s (129 MB/s) Selecting previously unselected package bsdextrautils. (Reading database ... 10487 files and directories currently installed.) Preparing to unpack .../00-bsdextrautils_2.36.1-7_amd64.deb ... Unpacking bsdextrautils (2.36.1-7) ... Selecting previously unselected package libuchardet0:amd64. Preparing to unpack .../01-libuchardet0_0.0.7-1_amd64.deb ... Unpacking libuchardet0:amd64 (0.0.7-1) ... Selecting previously unselected package groff-base. Preparing to unpack .../02-groff-base_1.22.4-6_amd64.deb ... Unpacking groff-base (1.22.4-6) ... Selecting previously unselected package libpipeline1:amd64. Preparing to unpack .../03-libpipeline1_1.5.3-1_amd64.deb ... Unpacking libpipeline1:amd64 (1.5.3-1) ... Selecting previously unselected package man-db. Preparing to unpack .../04-man-db_2.9.4-2_amd64.deb ... Unpacking man-db (2.9.4-2) ... Selecting previously unselected package perl-modules-5.32. Preparing to unpack .../05-perl-modules-5.32_5.32.1-4_all.deb ... Unpacking perl-modules-5.32 (5.32.1-4) ... Selecting previously unselected package libperl5.32:amd64. Preparing to unpack .../06-libperl5.32_5.32.1-4_amd64.deb ... Unpacking libperl5.32:amd64 (5.32.1-4) ... Selecting previously unselected package perl. Preparing to unpack .../07-perl_5.32.1-4_amd64.deb ... Unpacking perl (5.32.1-4) ... Selecting previously unselected package liblocale-gettext-perl. Preparing to unpack .../08-liblocale-gettext-perl_1.07-4+b1_amd64.deb ... Unpacking liblocale-gettext-perl (1.07-4+b1) ... Selecting previously unselected package poppler-data. Preparing to unpack .../09-poppler-data_0.4.10-1_all.deb ... Unpacking poppler-data (0.4.10-1) ... Selecting previously unselected package libpython3.9-minimal:amd64. Preparing to unpack .../10-libpython3.9-minimal_3.9.2-1_amd64.deb ... Unpacking libpython3.9-minimal:amd64 (3.9.2-1) ... Selecting previously unselected package libexpat1:amd64. Preparing to unpack .../11-libexpat1_2.2.10-2_amd64.deb ... Unpacking libexpat1:amd64 (2.2.10-2) ... Selecting previously unselected package python3.9-minimal. Preparing to unpack .../12-python3.9-minimal_3.9.2-1_amd64.deb ... Unpacking python3.9-minimal (3.9.2-1) ... Setting up libpython3.9-minimal:amd64 (3.9.2-1) ... Setting up libexpat1:amd64 (2.2.10-2) ... Setting up python3.9-minimal (3.9.2-1) ... Selecting previously unselected package python3-minimal. (Reading database ... 13857 files and directories currently installed.) Preparing to unpack .../0-python3-minimal_3.9.2-3_amd64.deb ... Unpacking python3-minimal (3.9.2-3) ... Selecting previously unselected package media-types. Preparing to unpack .../1-media-types_4.0.0_all.deb ... Unpacking media-types (4.0.0) ... Selecting previously unselected package libmpdec3:amd64. Preparing to unpack .../2-libmpdec3_2.5.1-2_amd64.deb ... Unpacking libmpdec3:amd64 (2.5.1-2) ... Selecting previously unselected package readline-common. Preparing to unpack .../3-readline-common_8.1-2_all.deb ... Unpacking readline-common (8.1-2) ... Selecting previously unselected package libreadline8:amd64. Preparing to unpack .../4-libreadline8_8.1-2_amd64.deb ... Unpacking libreadline8:amd64 (8.1-2) ... Selecting previously unselected package libsqlite3-0:amd64. Preparing to unpack .../5-libsqlite3-0_3.34.1-3_amd64.deb ... Unpacking libsqlite3-0:amd64 (3.34.1-3) ... Selecting previously unselected package libpython3.9-stdlib:amd64. Preparing to unpack .../6-libpython3.9-stdlib_3.9.2-1_amd64.deb ... Unpacking libpython3.9-stdlib:amd64 (3.9.2-1) ... Selecting previously unselected package python3.9. Preparing to unpack .../7-python3.9_3.9.2-1_amd64.deb ... Unpacking python3.9 (3.9.2-1) ... Selecting previously unselected package libpython3-stdlib:amd64. Preparing to unpack .../8-libpython3-stdlib_3.9.2-3_amd64.deb ... Unpacking libpython3-stdlib:amd64 (3.9.2-3) ... Setting up python3-minimal (3.9.2-3) ... Selecting previously unselected package python3. (Reading database ... 14286 files and directories currently installed.) Preparing to unpack .../000-python3_3.9.2-3_amd64.deb ... Unpacking python3 (3.9.2-3) ... Selecting previously unselected package sgml-base. Preparing to unpack .../001-sgml-base_1.30_all.deb ... Unpacking sgml-base (1.30) ... Selecting previously unselected package sensible-utils. Preparing to unpack .../002-sensible-utils_0.0.14_all.deb ... Unpacking sensible-utils (0.0.14) ... Selecting previously unselected package ucf. Preparing to unpack .../003-ucf_3.0043_all.deb ... Moving old data out of the way Unpacking ucf (3.0043) ... Selecting previously unselected package tex-common. Preparing to unpack .../004-tex-common_6.16_all.deb ... Unpacking tex-common (6.16) ... Selecting previously unselected package gcc-10-base:armel. Preparing to unpack .../005-gcc-10-base_10.2.1-6_armel.deb ... Unpacking gcc-10-base:armel (10.2.1-6) ... Selecting previously unselected package gcc-9-base:armel. Preparing to unpack .../006-gcc-9-base_9.4.0-1_armel.deb ... Unpacking gcc-9-base:armel (9.4.0-1) ... Selecting previously unselected package libmagic-mgc. Preparing to unpack .../007-libmagic-mgc_1%3a5.39-3_amd64.deb ... Unpacking libmagic-mgc (1:5.39-3) ... Selecting previously unselected package libmagic1:amd64. Preparing to unpack .../008-libmagic1_1%3a5.39-3_amd64.deb ... Unpacking libmagic1:amd64 (1:5.39-3) ... Selecting previously unselected package file. Preparing to unpack .../009-file_1%3a5.39-3_amd64.deb ... Unpacking file (1:5.39-3) ... Selecting previously unselected package gettext-base. Preparing to unpack .../010-gettext-base_0.21-4_amd64.deb ... Unpacking gettext-base (0.21-4) ... Selecting previously unselected package libsigsegv2:amd64. Preparing to unpack .../011-libsigsegv2_2.13-1_amd64.deb ... Unpacking libsigsegv2:amd64 (2.13-1) ... Selecting previously unselected package m4. Preparing to unpack .../012-m4_1.4.18-5_amd64.deb ... Unpacking m4 (1.4.18-5) ... Selecting previously unselected package autoconf. Preparing to unpack .../013-autoconf_2.69-14_all.deb ... Unpacking autoconf (2.69-14) ... Selecting previously unselected package autotools-dev. Preparing to unpack .../014-autotools-dev_20180224.1+nmu1_all.deb ... Unpacking autotools-dev (20180224.1+nmu1) ... Selecting previously unselected package automake. Preparing to unpack .../015-automake_1%3a1.16.3-2_all.deb ... Unpacking automake (1:1.16.3-2) ... Selecting previously unselected package autopoint. Preparing to unpack .../016-autopoint_0.21-4_all.deb ... Unpacking autopoint (0.21-4) ... Selecting previously unselected package binutils-arm-linux-gnueabi. Preparing to unpack .../017-binutils-arm-linux-gnueabi_2.35.2-2_amd64.deb ... Unpacking binutils-arm-linux-gnueabi (2.35.2-2) ... Selecting previously unselected package libcrypt-dev:amd64. Preparing to unpack .../018-libcrypt-dev_1%3a4.4.18-4_amd64.deb ... Unpacking libcrypt-dev:amd64 (1:4.4.18-4) ... Selecting previously unselected package libtirpc-dev:amd64. Preparing to unpack .../019-libtirpc-dev_1.3.1-1_amd64.deb ... Unpacking libtirpc-dev:amd64 (1.3.1-1) ... Selecting previously unselected package libnsl-dev:amd64. Preparing to unpack .../020-libnsl-dev_1.3.0-2_amd64.deb ... Unpacking libnsl-dev:amd64 (1.3.0-2) ... Selecting previously unselected package libc6-dev:amd64. Preparing to unpack .../021-libc6-dev_2.31-12_amd64.deb ... Unpacking libc6-dev:amd64 (2.31-12) ... Selecting previously unselected package libstdc++-10-dev:amd64. Preparing to unpack .../022-libstdc++-10-dev_10.2.1-6_amd64.deb ... Unpacking libstdc++-10-dev:amd64 (10.2.1-6) ... Selecting previously unselected package g++-10. Preparing to unpack .../023-g++-10_10.2.1-6_amd64.deb ... Unpacking g++-10 (10.2.1-6) ... Selecting previously unselected package g++. Preparing to unpack .../024-g++_4%3a10.2.1-1_amd64.deb ... Unpacking g++ (4:10.2.1-1) ... Selecting previously unselected package libdpkg-perl. Preparing to unpack .../025-libdpkg-perl_1.20.9_all.deb ... Unpacking libdpkg-perl (1.20.9) ... Selecting previously unselected package dpkg-dev. Preparing to unpack .../026-dpkg-dev_1.20.9_all.deb ... Unpacking dpkg-dev (1.20.9) ... Selecting previously unselected package build-essential. Preparing to unpack .../027-build-essential_12.9_amd64.deb ... Unpacking build-essential (12.9) ... Selecting previously unselected package gcc-10-arm-linux-gnueabi-base:amd64. Preparing to unpack .../028-gcc-10-arm-linux-gnueabi-base_10.2.1-6cross1_amd64.deb ... Unpacking gcc-10-arm-linux-gnueabi-base:amd64 (10.2.1-6cross1) ... Selecting previously unselected package cpp-10-arm-linux-gnueabi. Preparing to unpack .../029-cpp-10-arm-linux-gnueabi_10.2.1-6cross1_amd64.deb ... Unpacking cpp-10-arm-linux-gnueabi (10.2.1-6cross1) ... Selecting previously unselected package cpp-arm-linux-gnueabi. Preparing to unpack .../030-cpp-arm-linux-gnueabi_4%3a10.2.1-1_amd64.deb ... Unpacking cpp-arm-linux-gnueabi (4:10.2.1-1) ... Selecting previously unselected package cross-config. Preparing to unpack .../031-cross-config_2.6.18+nmu1_all.deb ... Unpacking cross-config (2.6.18+nmu1) ... Selecting previously unselected package gcc-10-cross-base. Preparing to unpack .../032-gcc-10-cross-base_10.2.1-6cross1_all.deb ... Unpacking gcc-10-cross-base (10.2.1-6cross1) ... Selecting previously unselected package libc6-armel-cross. Preparing to unpack .../033-libc6-armel-cross_2.31-9cross4_all.deb ... Unpacking libc6-armel-cross (2.31-9cross4) ... Selecting previously unselected package libgcc-s1-armel-cross. Preparing to unpack .../034-libgcc-s1-armel-cross_10.2.1-6cross1_all.deb ... Unpacking libgcc-s1-armel-cross (10.2.1-6cross1) ... Selecting previously unselected package libgomp1-armel-cross. Preparing to unpack .../035-libgomp1-armel-cross_10.2.1-6cross1_all.deb ... Unpacking libgomp1-armel-cross (10.2.1-6cross1) ... Selecting previously unselected package libatomic1-armel-cross. Preparing to unpack .../036-libatomic1-armel-cross_10.2.1-6cross1_all.deb ... Unpacking libatomic1-armel-cross (10.2.1-6cross1) ... Selecting previously unselected package libasan6-armel-cross. Preparing to unpack .../037-libasan6-armel-cross_10.2.1-6cross1_all.deb ... Unpacking libasan6-armel-cross (10.2.1-6cross1) ... Selecting previously unselected package libstdc++6-armel-cross. Preparing to unpack .../038-libstdc++6-armel-cross_10.2.1-6cross1_all.deb ... Unpacking libstdc++6-armel-cross (10.2.1-6cross1) ... Selecting previously unselected package libubsan1-armel-cross. Preparing to unpack .../039-libubsan1-armel-cross_10.2.1-6cross1_all.deb ... Unpacking libubsan1-armel-cross (10.2.1-6cross1) ... Selecting previously unselected package libgcc-10-dev-armel-cross. Preparing to unpack .../040-libgcc-10-dev-armel-cross_10.2.1-6cross1_all.deb ... Unpacking libgcc-10-dev-armel-cross (10.2.1-6cross1) ... Selecting previously unselected package gcc-10-arm-linux-gnueabi. Preparing to unpack .../041-gcc-10-arm-linux-gnueabi_10.2.1-6cross1_amd64.deb ... Unpacking gcc-10-arm-linux-gnueabi (10.2.1-6cross1) ... Selecting previously unselected package gcc-arm-linux-gnueabi. Preparing to unpack .../042-gcc-arm-linux-gnueabi_4%3a10.2.1-1_amd64.deb ... Unpacking gcc-arm-linux-gnueabi (4:10.2.1-1) ... Selecting previously unselected package linux-libc-dev-armel-cross. Preparing to unpack .../043-linux-libc-dev-armel-cross_5.10.13-1cross4_all.deb ... Unpacking linux-libc-dev-armel-cross (5.10.13-1cross4) ... Selecting previously unselected package libc6-dev-armel-cross. Preparing to unpack .../044-libc6-dev-armel-cross_2.31-9cross4_all.deb ... Unpacking libc6-dev-armel-cross (2.31-9cross4) ... Selecting previously unselected package libstdc++-10-dev-armel-cross. Preparing to unpack .../045-libstdc++-10-dev-armel-cross_10.2.1-6cross1_all.deb ... Unpacking libstdc++-10-dev-armel-cross (10.2.1-6cross1) ... Selecting previously unselected package g++-10-arm-linux-gnueabi. Preparing to unpack .../046-g++-10-arm-linux-gnueabi_10.2.1-6cross1_amd64.deb ... Unpacking g++-10-arm-linux-gnueabi (10.2.1-6cross1) ... Selecting previously unselected package g++-arm-linux-gnueabi. Preparing to unpack .../047-g++-arm-linux-gnueabi_4%3a10.2.1-1_amd64.deb ... Unpacking g++-arm-linux-gnueabi (4:10.2.1-1) ... Selecting previously unselected package libconfig-inifiles-perl. Preparing to unpack .../048-libconfig-inifiles-perl_3.000003-1_all.deb ... Unpacking libconfig-inifiles-perl (3.000003-1) ... Selecting previously unselected package libio-string-perl. Preparing to unpack .../049-libio-string-perl_1.08-3.1_all.deb ... Unpacking libio-string-perl (1.08-3.1) ... Selecting previously unselected package libicu67:amd64. Preparing to unpack .../050-libicu67_67.1-6_amd64.deb ... Unpacking libicu67:amd64 (67.1-6) ... Selecting previously unselected package libxml2:amd64. Preparing to unpack .../051-libxml2_2.9.10+dfsg-6.7_amd64.deb ... Unpacking libxml2:amd64 (2.9.10+dfsg-6.7) ... Selecting previously unselected package libxml-namespacesupport-perl. Preparing to unpack .../052-libxml-namespacesupport-perl_1.12-1.1_all.deb ... Unpacking libxml-namespacesupport-perl (1.12-1.1) ... Selecting previously unselected package libxml-sax-base-perl. Preparing to unpack .../053-libxml-sax-base-perl_1.09-1.1_all.deb ... Unpacking libxml-sax-base-perl (1.09-1.1) ... Selecting previously unselected package libxml-sax-perl. Preparing to unpack .../054-libxml-sax-perl_1.02+dfsg-1_all.deb ... Unpacking libxml-sax-perl (1.02+dfsg-1) ... Selecting previously unselected package libxml-libxml-perl. Preparing to unpack .../055-libxml-libxml-perl_2.0134+dfsg-2+b1_amd64.deb ... Unpacking libxml-libxml-perl (2.0134+dfsg-2+b1) ... Selecting previously unselected package libxml-simple-perl. Preparing to unpack .../056-libxml-simple-perl_2.25-1_all.deb ... Unpacking libxml-simple-perl (2.25-1) ... Selecting previously unselected package libyaml-perl. Preparing to unpack .../057-libyaml-perl_1.30-1_all.deb ... Unpacking libyaml-perl (1.30-1) ... Selecting previously unselected package libconfig-auto-perl. Preparing to unpack .../058-libconfig-auto-perl_0.44-1.1_all.deb ... Unpacking libconfig-auto-perl (0.44-1.1) ... Selecting previously unselected package libfile-which-perl. Preparing to unpack .../059-libfile-which-perl_1.23-1_all.deb ... Unpacking libfile-which-perl (1.23-1) ... Selecting previously unselected package libfile-homedir-perl. Preparing to unpack .../060-libfile-homedir-perl_1.006-1_all.deb ... Unpacking libfile-homedir-perl (1.006-1) ... Selecting previously unselected package libdebian-dpkgcross-perl. Preparing to unpack .../061-libdebian-dpkgcross-perl_2.6.18+nmu1_all.deb ... Unpacking libdebian-dpkgcross-perl (2.6.18+nmu1) ... Selecting previously unselected package dpkg-cross. Preparing to unpack .../062-dpkg-cross_2.6.18+nmu1_all.deb ... Unpacking dpkg-cross (2.6.18+nmu1) ... Selecting previously unselected package crossbuild-essential-armel. Preparing to unpack .../063-crossbuild-essential-armel_12.9_all.deb ... Unpacking crossbuild-essential-armel (12.9) ... Selecting previously unselected package libdebhelper-perl. Preparing to unpack .../064-libdebhelper-perl_13.3.4_all.deb ... Unpacking libdebhelper-perl (13.3.4) ... Selecting previously unselected package libtool. Preparing to unpack .../065-libtool_2.4.6-15_all.deb ... Unpacking libtool (2.4.6-15) ... Selecting previously unselected package dh-autoreconf. Preparing to unpack .../066-dh-autoreconf_20_all.deb ... Unpacking dh-autoreconf (20) ... Selecting previously unselected package libarchive-zip-perl. Preparing to unpack .../067-libarchive-zip-perl_1.68-1_all.deb ... Unpacking libarchive-zip-perl (1.68-1) ... Selecting previously unselected package libsub-override-perl. Preparing to unpack .../068-libsub-override-perl_0.09-2_all.deb ... Unpacking libsub-override-perl (0.09-2) ... Selecting previously unselected package libfile-stripnondeterminism-perl. Preparing to unpack .../069-libfile-stripnondeterminism-perl_1.12.0-1_all.deb ... Unpacking libfile-stripnondeterminism-perl (1.12.0-1) ... Selecting previously unselected package dh-strip-nondeterminism. Preparing to unpack .../070-dh-strip-nondeterminism_1.12.0-1_all.deb ... Unpacking dh-strip-nondeterminism (1.12.0-1) ... Selecting previously unselected package libelf1:amd64. Preparing to unpack .../071-libelf1_0.183-3_amd64.deb ... Unpacking libelf1:amd64 (0.183-3) ... Selecting previously unselected package dwz. Preparing to unpack .../072-dwz_0.14-1_amd64.deb ... Unpacking dwz (0.14-1) ... Selecting previously unselected package gettext. Preparing to unpack .../073-gettext_0.21-4_amd64.deb ... Unpacking gettext (0.21-4) ... Selecting previously unselected package intltool-debian. Preparing to unpack .../074-intltool-debian_0.35.0+20060710.5_all.deb ... Unpacking intltool-debian (0.35.0+20060710.5) ... Selecting previously unselected package po-debconf. Preparing to unpack .../075-po-debconf_1.0.21+nmu1_all.deb ... Unpacking po-debconf (1.0.21+nmu1) ... Selecting previously unselected package debhelper. Preparing to unpack .../076-debhelper_13.3.4_all.deb ... Unpacking debhelper (13.3.4) ... Selecting previously unselected package xml-core. Preparing to unpack .../077-xml-core_0.18+nmu1_all.deb ... Unpacking xml-core (0.18+nmu1) ... Selecting previously unselected package sgml-data. Preparing to unpack .../078-sgml-data_2.0.11+nmu1_all.deb ... Unpacking sgml-data (2.0.11+nmu1) ... Selecting previously unselected package docbook. Preparing to unpack .../079-docbook_4.5-6_all.deb ... Unpacking docbook (4.5-6) ... Selecting previously unselected package libosp5. Preparing to unpack .../080-libosp5_1.5.2-13+b2_amd64.deb ... Unpacking libosp5 (1.5.2-13+b2) ... Selecting previously unselected package opensp. Preparing to unpack .../081-opensp_1.5.2-13+b2_amd64.deb ... Unpacking opensp (1.5.2-13+b2) ... Selecting previously unselected package docbook-to-man. Preparing to unpack .../082-docbook-to-man_1%3a2.0.0-45_amd64.deb ... Unpacking docbook-to-man (1:2.0.0-45) ... Selecting previously unselected package fonts-dejavu-core. Preparing to unpack .../083-fonts-dejavu-core_2.37-2_all.deb ... Unpacking fonts-dejavu-core (2.37-2) ... Selecting previously unselected package fonts-urw-base35. Preparing to unpack .../084-fonts-urw-base35_20200910-1_all.deb ... Unpacking fonts-urw-base35 (20200910-1) ... Selecting previously unselected package fontconfig-config. Preparing to unpack .../085-fontconfig-config_2.13.1-4.2_all.deb ... Unpacking fontconfig-config (2.13.1-4.2) ... Selecting previously unselected package fonts-lmodern. Preparing to unpack .../086-fonts-lmodern_2.004.5-6.1_all.deb ... Unpacking fonts-lmodern (2.004.5-6.1) ... Selecting previously unselected package libgs9-common. Preparing to unpack .../087-libgs9-common_9.53.3~dfsg-7_all.deb ... Unpacking libgs9-common (9.53.3~dfsg-7) ... Selecting previously unselected package libavahi-common-data:amd64. Preparing to unpack .../088-libavahi-common-data_0.8-5_amd64.deb ... Unpacking libavahi-common-data:amd64 (0.8-5) ... Selecting previously unselected package libavahi-common3:amd64. Preparing to unpack .../089-libavahi-common3_0.8-5_amd64.deb ... Unpacking libavahi-common3:amd64 (0.8-5) ... Selecting previously unselected package libdbus-1-3:amd64. Preparing to unpack .../090-libdbus-1-3_1.12.20-2_amd64.deb ... Unpacking libdbus-1-3:amd64 (1.12.20-2) ... Selecting previously unselected package libavahi-client3:amd64. Preparing to unpack .../091-libavahi-client3_0.8-5_amd64.deb ... Unpacking libavahi-client3:amd64 (0.8-5) ... Selecting previously unselected package libcups2:amd64. Preparing to unpack .../092-libcups2_2.3.3op2-3+deb11u1_amd64.deb ... Unpacking libcups2:amd64 (2.3.3op2-3+deb11u1) ... Selecting previously unselected package libbrotli1:amd64. Preparing to unpack .../093-libbrotli1_1.0.9-2+b2_amd64.deb ... Unpacking libbrotli1:amd64 (1.0.9-2+b2) ... Selecting previously unselected package libpng16-16:amd64. Preparing to unpack .../094-libpng16-16_1.6.37-3_amd64.deb ... Unpacking libpng16-16:amd64 (1.6.37-3) ... Selecting previously unselected package libfreetype6:amd64. Preparing to unpack .../095-libfreetype6_2.10.4+dfsg-1_amd64.deb ... Unpacking libfreetype6:amd64 (2.10.4+dfsg-1) ... Selecting previously unselected package libfontconfig1:amd64. Preparing to unpack .../096-libfontconfig1_2.13.1-4.2_amd64.deb ... Unpacking libfontconfig1:amd64 (2.13.1-4.2) ... Selecting previously unselected package libidn11:amd64. Preparing to unpack .../097-libidn11_1.33-3_amd64.deb ... Unpacking libidn11:amd64 (1.33-3) ... Selecting previously unselected package libijs-0.35:amd64. Preparing to unpack .../098-libijs-0.35_0.35-15_amd64.deb ... Unpacking libijs-0.35:amd64 (0.35-15) ... Selecting previously unselected package libjbig2dec0:amd64. Preparing to unpack .../099-libjbig2dec0_0.19-3_amd64.deb ... Unpacking libjbig2dec0:amd64 (0.19-3) ... Selecting previously unselected package libjpeg62-turbo:amd64. Preparing to unpack .../100-libjpeg62-turbo_1%3a2.0.6-4_amd64.deb ... Unpacking libjpeg62-turbo:amd64 (1:2.0.6-4) ... Selecting previously unselected package liblcms2-2:amd64. Preparing to unpack .../101-liblcms2-2_2.12~rc1-2_amd64.deb ... Unpacking liblcms2-2:amd64 (2.12~rc1-2) ... Selecting previously unselected package libopenjp2-7:amd64. Preparing to unpack .../102-libopenjp2-7_2.4.0-3_amd64.deb ... Unpacking libopenjp2-7:amd64 (2.4.0-3) ... Selecting previously unselected package libpaper1:amd64. Preparing to unpack .../103-libpaper1_1.1.28+b1_amd64.deb ... Unpacking libpaper1:amd64 (1.1.28+b1) ... Selecting previously unselected package libdeflate0:amd64. Preparing to unpack .../104-libdeflate0_1.7-1_amd64.deb ... Unpacking libdeflate0:amd64 (1.7-1) ... Selecting previously unselected package libjbig0:amd64. Preparing to unpack .../105-libjbig0_2.1-3.1+b2_amd64.deb ... Unpacking libjbig0:amd64 (2.1-3.1+b2) ... Selecting previously unselected package libwebp6:amd64. Preparing to unpack .../106-libwebp6_0.6.1-2+b1_amd64.deb ... Unpacking libwebp6:amd64 (0.6.1-2+b1) ... Selecting previously unselected package libtiff5:amd64. Preparing to unpack .../107-libtiff5_4.2.0-1_amd64.deb ... Unpacking libtiff5:amd64 (4.2.0-1) ... Selecting previously unselected package libgs9:amd64. Preparing to unpack .../108-libgs9_9.53.3~dfsg-7_amd64.deb ... Unpacking libgs9:amd64 (9.53.3~dfsg-7) ... Selecting previously unselected package ghostscript. Preparing to unpack .../109-ghostscript_9.53.3~dfsg-7_amd64.deb ... Unpacking ghostscript (9.53.3~dfsg-7) ... Selecting previously unselected package libnetpbm10. Preparing to unpack .../110-libnetpbm10_2%3a10.0-15.4_amd64.deb ... Unpacking libnetpbm10 (2:10.0-15.4) ... Selecting previously unselected package netpbm. Preparing to unpack .../111-netpbm_2%3a10.0-15.4_amd64.deb ... Unpacking netpbm (2:10.0-15.4) ... Selecting previously unselected package libpaper-utils. Preparing to unpack .../112-libpaper-utils_1.1.28+b1_amd64.deb ... Unpacking libpaper-utils (1.1.28+b1) ... Selecting previously unselected package libkpathsea6:amd64. Preparing to unpack .../113-libkpathsea6_2020.20200327.54578-7_amd64.deb ... Unpacking libkpathsea6:amd64 (2020.20200327.54578-7) ... Selecting previously unselected package libptexenc1:amd64. Preparing to unpack .../114-libptexenc1_2020.20200327.54578-7_amd64.deb ... Unpacking libptexenc1:amd64 (2020.20200327.54578-7) ... Selecting previously unselected package libsynctex2:amd64. Preparing to unpack .../115-libsynctex2_2020.20200327.54578-7_amd64.deb ... Unpacking libsynctex2:amd64 (2020.20200327.54578-7) ... Selecting previously unselected package libtexlua53:amd64. Preparing to unpack .../116-libtexlua53_2020.20200327.54578-7_amd64.deb ... Unpacking libtexlua53:amd64 (2020.20200327.54578-7) ... Selecting previously unselected package libtexluajit2:amd64. Preparing to unpack .../117-libtexluajit2_2020.20200327.54578-7_amd64.deb ... Unpacking libtexluajit2:amd64 (2020.20200327.54578-7) ... Selecting previously unselected package t1utils. Preparing to unpack .../118-t1utils_1.41-4_amd64.deb ... Unpacking t1utils (1.41-4) ... Selecting previously unselected package libpixman-1-0:amd64. Preparing to unpack .../119-libpixman-1-0_0.40.0-1_amd64.deb ... Unpacking libpixman-1-0:amd64 (0.40.0-1) ... Selecting previously unselected package libxau6:amd64. Preparing to unpack .../120-libxau6_1%3a1.0.9-1_amd64.deb ... Unpacking libxau6:amd64 (1:1.0.9-1) ... Selecting previously unselected package libmd0:amd64. Preparing to unpack .../121-libmd0_1.0.3-3_amd64.deb ... Unpacking libmd0:amd64 (1.0.3-3) ... Selecting previously unselected package libbsd0:amd64. Preparing to unpack .../122-libbsd0_0.11.3-1_amd64.deb ... Unpacking libbsd0:amd64 (0.11.3-1) ... Selecting previously unselected package libxdmcp6:amd64. Preparing to unpack .../123-libxdmcp6_1%3a1.1.2-3_amd64.deb ... Unpacking libxdmcp6:amd64 (1:1.1.2-3) ... Selecting previously unselected package libxcb1:amd64. Preparing to unpack .../124-libxcb1_1.14-3_amd64.deb ... Unpacking libxcb1:amd64 (1.14-3) ... Selecting previously unselected package libx11-data. Preparing to unpack .../125-libx11-data_2%3a1.7.1-1_all.deb ... Unpacking libx11-data (2:1.7.1-1) ... Selecting previously unselected package libx11-6:amd64. Preparing to unpack .../126-libx11-6_2%3a1.7.1-1_amd64.deb ... Unpacking libx11-6:amd64 (2:1.7.1-1) ... Selecting previously unselected package libxcb-render0:amd64. Preparing to unpack .../127-libxcb-render0_1.14-3_amd64.deb ... Unpacking libxcb-render0:amd64 (1.14-3) ... Selecting previously unselected package libxcb-shm0:amd64. Preparing to unpack .../128-libxcb-shm0_1.14-3_amd64.deb ... Unpacking libxcb-shm0:amd64 (1.14-3) ... Selecting previously unselected package libxext6:amd64. Preparing to unpack .../129-libxext6_2%3a1.3.3-1.1_amd64.deb ... Unpacking libxext6:amd64 (2:1.3.3-1.1) ... Selecting previously unselected package libxrender1:amd64. Preparing to unpack .../130-libxrender1_1%3a0.9.10-1_amd64.deb ... Unpacking libxrender1:amd64 (1:0.9.10-1) ... Selecting previously unselected package libcairo2:amd64. Preparing to unpack .../131-libcairo2_1.16.0-5_amd64.deb ... Unpacking libcairo2:amd64 (1.16.0-5) ... Selecting previously unselected package libgraphite2-3:amd64. Preparing to unpack .../132-libgraphite2-3_1.3.14-1_amd64.deb ... Unpacking libgraphite2-3:amd64 (1.3.14-1) ... Selecting previously unselected package libglib2.0-0:amd64. Preparing to unpack .../133-libglib2.0-0_2.66.8-1_amd64.deb ... Unpacking libglib2.0-0:amd64 (2.66.8-1) ... Selecting previously unselected package libharfbuzz0b:amd64. Preparing to unpack .../134-libharfbuzz0b_2.7.4-1_amd64.deb ... Unpacking libharfbuzz0b:amd64 (2.7.4-1) ... Selecting previously unselected package libteckit0:amd64. Preparing to unpack .../135-libteckit0_2.5.10+ds1-3_amd64.deb ... Unpacking libteckit0:amd64 (2.5.10+ds1-3) ... Selecting previously unselected package x11-common. Preparing to unpack .../136-x11-common_1%3a7.7+22_all.deb ... Unpacking x11-common (1:7.7+22) ... Selecting previously unselected package libice6:amd64. Preparing to unpack .../137-libice6_2%3a1.0.10-1_amd64.deb ... Unpacking libice6:amd64 (2:1.0.10-1) ... Selecting previously unselected package libsm6:amd64. Preparing to unpack .../138-libsm6_2%3a1.2.3-1_amd64.deb ... Unpacking libsm6:amd64 (2:1.2.3-1) ... Selecting previously unselected package libxt6:amd64. Preparing to unpack .../139-libxt6_1%3a1.2.0-1_amd64.deb ... Unpacking libxt6:amd64 (1:1.2.0-1) ... Selecting previously unselected package libxmu6:amd64. Preparing to unpack .../140-libxmu6_2%3a1.1.2-2+b3_amd64.deb ... Unpacking libxmu6:amd64 (2:1.1.2-2+b3) ... Selecting previously unselected package libxpm4:amd64. Preparing to unpack .../141-libxpm4_1%3a3.5.12-1_amd64.deb ... Unpacking libxpm4:amd64 (1:3.5.12-1) ... Selecting previously unselected package libxaw7:amd64. Preparing to unpack .../142-libxaw7_2%3a1.0.13-1.1_amd64.deb ... Unpacking libxaw7:amd64 (2:1.0.13-1.1) ... Selecting previously unselected package libxi6:amd64. Preparing to unpack .../143-libxi6_2%3a1.7.10-1_amd64.deb ... Unpacking libxi6:amd64 (2:1.7.10-1) ... Selecting previously unselected package libzzip-0-13:amd64. Preparing to unpack .../144-libzzip-0-13_0.13.62-3.3_amd64.deb ... Unpacking libzzip-0-13:amd64 (0.13.62-3.3) ... Selecting previously unselected package texlive-binaries. Preparing to unpack .../145-texlive-binaries_2020.20200327.54578-7_amd64.deb ... Unpacking texlive-binaries (2020.20200327.54578-7) ... Selecting previously unselected package xdg-utils. Preparing to unpack .../146-xdg-utils_1.1.3-4.1_all.deb ... Unpacking xdg-utils (1.1.3-4.1) ... Selecting previously unselected package texlive-base. Preparing to unpack .../147-texlive-base_2020.20210202-3_all.deb ... Unpacking texlive-base (2020.20210202-3) ... Selecting previously unselected package hevea. Preparing to unpack .../148-hevea_2.34-2+b1_amd64.deb ... Unpacking hevea (2.34-2+b1) ... Selecting previously unselected package libgcc-s1:armel. Preparing to unpack .../149-libgcc-s1_10.2.1-6_armel.deb ... Unpacking libgcc-s1:armel (10.2.1-6) ... Selecting previously unselected package libcrypt1:armel. Preparing to unpack .../150-libcrypt1_1%3a4.4.18-4_armel.deb ... Unpacking libcrypt1:armel (1:4.4.18-4) ... Selecting previously unselected package libc6:armel. Preparing to unpack .../151-libc6_2.31-12_armel.deb ... Unpacking libc6:armel (2.31-12) ... Selecting previously unselected package libasan5:armel. Preparing to unpack .../152-libasan5_9.4.0-1_armel.deb ... Unpacking libasan5:armel (9.4.0-1) ... Selecting previously unselected package libatomic1:armel. Preparing to unpack .../153-libatomic1_10.2.1-6_armel.deb ... Unpacking libatomic1:armel (10.2.1-6) ... Selecting previously unselected package libblkid1:armel. Preparing to unpack .../154-libblkid1_2.36.1-7_armel.deb ... Unpacking libblkid1:armel (2.36.1-7) ... Selecting previously unselected package linux-libc-dev:armel. Preparing to unpack .../155-linux-libc-dev_5.10.40-1_armel.deb ... Unpacking linux-libc-dev:armel (5.10.40-1) ... Selecting previously unselected package libcrypt-dev:armel. Preparing to unpack .../156-libcrypt-dev_1%3a4.4.18-4_armel.deb ... Unpacking libcrypt-dev:armel (1:4.4.18-4) ... Selecting previously unselected package libcom-err2:armel. Preparing to unpack .../157-libcom-err2_1.46.2-1_armel.deb ... Unpacking libcom-err2:armel (1.46.2-1) ... Selecting previously unselected package libkrb5support0:armel. Preparing to unpack .../158-libkrb5support0_1.18.3-5_armel.deb ... Unpacking libkrb5support0:armel (1.18.3-5) ... Selecting previously unselected package libk5crypto3:armel. Preparing to unpack .../159-libk5crypto3_1.18.3-5_armel.deb ... Unpacking libk5crypto3:armel (1.18.3-5) ... Selecting previously unselected package libkeyutils1:armel. Preparing to unpack .../160-libkeyutils1_1.6.1-2_armel.deb ... Unpacking libkeyutils1:armel (1.6.1-2) ... Selecting previously unselected package libssl1.1:armel. Preparing to unpack .../161-libssl1.1_1.1.1k-1_armel.deb ... Unpacking libssl1.1:armel (1.1.1k-1) ... Selecting previously unselected package libkrb5-3:armel. Preparing to unpack .../162-libkrb5-3_1.18.3-5_armel.deb ... Unpacking libkrb5-3:armel (1.18.3-5) ... Selecting previously unselected package libgssapi-krb5-2:armel. Preparing to unpack .../163-libgssapi-krb5-2_1.18.3-5_armel.deb ... Unpacking libgssapi-krb5-2:armel (1.18.3-5) ... Selecting previously unselected package libtirpc3:armel. Preparing to unpack .../164-libtirpc3_1.3.1-1_armel.deb ... Unpacking libtirpc3:armel (1.3.1-1) ... Selecting previously unselected package libnsl2:armel. Preparing to unpack .../165-libnsl2_1.3.0-2_armel.deb ... Unpacking libnsl2:armel (1.3.0-2) ... Selecting previously unselected package libtirpc-dev:armel. Preparing to unpack .../166-libtirpc-dev_1.3.1-1_armel.deb ... Unpacking libtirpc-dev:armel (1.3.1-1) ... Selecting previously unselected package libnsl-dev:armel. Preparing to unpack .../167-libnsl-dev_1.3.0-2_armel.deb ... Unpacking libnsl-dev:armel (1.3.0-2) ... Selecting previously unselected package libc6-dev:armel. Preparing to unpack .../168-libc6-dev_2.31-12_armel.deb ... Unpacking libc6-dev:armel (2.31-12) ... Selecting previously unselected package libuuid1:armel. Preparing to unpack .../169-libuuid1_2.36.1-7_armel.deb ... Unpacking libuuid1:armel (2.36.1-7) ... Selecting previously unselected package uuid-dev:armel. Preparing to unpack .../170-uuid-dev_2.36.1-7_armel.deb ... Unpacking uuid-dev:armel (2.36.1-7) ... Selecting previously unselected package libblkid-dev:armel. Preparing to unpack .../171-libblkid-dev_2.36.1-7_armel.deb ... Unpacking libblkid-dev:armel (2.36.1-7) ... Selecting previously unselected package libdatrie1:amd64. Preparing to unpack .../172-libdatrie1_0.2.13-1_amd64.deb ... Unpacking libdatrie1:amd64 (0.2.13-1) ... Selecting previously unselected package libffi7:armel. Preparing to unpack .../173-libffi7_3.3-6_armel.deb ... Unpacking libffi7:armel (3.3-6) ... Selecting previously unselected package libffi-dev:armel. Preparing to unpack .../174-libffi-dev_3.3-6_armel.deb ... Unpacking libffi-dev:armel (3.3-6) ... Selecting previously unselected package libfontenc1:amd64. Preparing to unpack .../175-libfontenc1_1%3a1.1.4-1_amd64.deb ... Unpacking libfontenc1:amd64 (1:1.1.4-1) ... Selecting previously unselected package libgomp1:armel. Preparing to unpack .../176-libgomp1_10.2.1-6_armel.deb ... Unpacking libgomp1:armel (10.2.1-6) ... Selecting previously unselected package libstdc++6:armel. Preparing to unpack .../177-libstdc++6_10.2.1-6_armel.deb ... Unpacking libstdc++6:armel (10.2.1-6) ... Selecting previously unselected package libubsan1:armel. Preparing to unpack .../178-libubsan1_10.2.1-6_armel.deb ... Unpacking libubsan1:armel (10.2.1-6) ... Selecting previously unselected package libgcc-9-dev:armel. Preparing to unpack .../179-libgcc-9-dev_9.4.0-1_armel.deb ... Unpacking libgcc-9-dev:armel (9.4.0-1) ... Selecting previously unselected package libpcre2-8-0:armel. Preparing to unpack .../180-libpcre2-8-0_10.36-2_armel.deb ... Unpacking libpcre2-8-0:armel (10.36-2) ... Selecting previously unselected package libselinux1:armel. Preparing to unpack .../181-libselinux1_3.1-3_armel.deb ... Unpacking libselinux1:armel (3.1-3) ... Selecting previously unselected package libmount1:armel. Preparing to unpack .../182-libmount1_2.36.1-7_armel.deb ... Unpacking libmount1:armel (2.36.1-7) ... Selecting previously unselected package libpcre3:armel. Preparing to unpack .../183-libpcre3_2%3a8.39-13_armel.deb ... Unpacking libpcre3:armel (2:8.39-13) ... Selecting previously unselected package zlib1g:armel. Preparing to unpack .../184-zlib1g_1%3a1.2.11.dfsg-2_armel.deb ... Unpacking zlib1g:armel (1:1.2.11.dfsg-2) ... Selecting previously unselected package libglib2.0-0:armel. Preparing to unpack .../185-libglib2.0-0_2.66.8-1_armel.deb ... Unpacking libglib2.0-0:armel (2.66.8-1) ... Selecting previously unselected package libglib2.0-data. Preparing to unpack .../186-libglib2.0-data_2.66.8-1_all.deb ... Unpacking libglib2.0-data (2.66.8-1) ... Selecting previously unselected package libglib2.0-bin. Preparing to unpack .../187-libglib2.0-bin_2.66.8-1_amd64.deb ... Unpacking libglib2.0-bin (2.66.8-1) ... Selecting previously unselected package python3-lib2to3. Preparing to unpack .../188-python3-lib2to3_3.9.2-1_all.deb ... Unpacking python3-lib2to3 (3.9.2-1) ... Selecting previously unselected package python3-distutils. Preparing to unpack .../189-python3-distutils_3.9.2-1_all.deb ... Unpacking python3-distutils (3.9.2-1) ... Selecting previously unselected package libglib2.0-dev-bin. Preparing to unpack .../190-libglib2.0-dev-bin_2.66.8-1_amd64.deb ... Unpacking libglib2.0-dev-bin (2.66.8-1) ... Selecting previously unselected package libsepol1:armel. Preparing to unpack .../191-libsepol1_3.1-1_armel.deb ... Unpacking libsepol1:armel (3.1-1) ... Selecting previously unselected package libsepol1-dev:armel. Preparing to unpack .../192-libsepol1-dev_3.1-1_armel.deb ... Unpacking libsepol1-dev:armel (3.1-1) ... Selecting previously unselected package libpcre2-16-0:armel. Preparing to unpack .../193-libpcre2-16-0_10.36-2_armel.deb ... Unpacking libpcre2-16-0:armel (10.36-2) ... Selecting previously unselected package libpcre2-32-0:armel. Preparing to unpack .../194-libpcre2-32-0_10.36-2_armel.deb ... Unpacking libpcre2-32-0:armel (10.36-2) ... Selecting previously unselected package libpcre2-posix2:armel. Preparing to unpack .../195-libpcre2-posix2_10.36-2_armel.deb ... Unpacking libpcre2-posix2:armel (10.36-2) ... Selecting previously unselected package libpcre2-dev:armel. Preparing to unpack .../196-libpcre2-dev_10.36-2_armel.deb ... Unpacking libpcre2-dev:armel (10.36-2) ... Selecting previously unselected package libselinux1-dev:armel. Preparing to unpack .../197-libselinux1-dev_3.1-3_armel.deb ... Unpacking libselinux1-dev:armel (3.1-3) ... Selecting previously unselected package libmount-dev:armel. Preparing to unpack .../198-libmount-dev_2.36.1-7_armel.deb ... Unpacking libmount-dev:armel (2.36.1-7) ... Selecting previously unselected package libpcre16-3:armel. Preparing to unpack .../199-libpcre16-3_2%3a8.39-13_armel.deb ... Unpacking libpcre16-3:armel (2:8.39-13) ... Selecting previously unselected package libpcre32-3:armel. Preparing to unpack .../200-libpcre32-3_2%3a8.39-13_armel.deb ... Unpacking libpcre32-3:armel (2:8.39-13) ... Selecting previously unselected package libpcrecpp0v5:armel. Preparing to unpack .../201-libpcrecpp0v5_2%3a8.39-13_armel.deb ... Unpacking libpcrecpp0v5:armel (2:8.39-13) ... Selecting previously unselected package libpcre3-dev:armel. Preparing to unpack .../202-libpcre3-dev_2%3a8.39-13_armel.deb ... Unpacking libpcre3-dev:armel (2:8.39-13) ... Selecting previously unselected package pkg-config. Preparing to unpack .../203-pkg-config_0.29.2-1_amd64.deb ... Unpacking pkg-config (0.29.2-1) ... Selecting previously unselected package zlib1g-dev:armel. Preparing to unpack .../204-zlib1g-dev_1%3a1.2.11.dfsg-2_armel.deb ... Unpacking zlib1g-dev:armel (1:1.2.11.dfsg-2) ... Selecting previously unselected package libglib2.0-dev:armel. Preparing to unpack .../205-libglib2.0-dev_2.66.8-1_armel.deb ... Unpacking libglib2.0-dev:armel (2.66.8-1) ... Selecting previously unselected package libjs-jquery. Preparing to unpack .../206-libjs-jquery_3.5.1+dfsg+~3.5.5-7_all.deb ... Unpacking libjs-jquery (3.5.1+dfsg+~3.5.5-7) ... Selecting previously unselected package libmime-charset-perl. Preparing to unpack .../207-libmime-charset-perl_1.012.2-1_all.deb ... Unpacking libmime-charset-perl (1.012.2-1) ... Selecting previously unselected package libthai-data. Preparing to unpack .../208-libthai-data_0.1.28-4_all.deb ... Unpacking libthai-data (0.1.28-4) ... Selecting previously unselected package libthai0:amd64. Preparing to unpack .../209-libthai0_0.1.28-4_amd64.deb ... Unpacking libthai0:amd64 (0.1.28-4) ... Selecting previously unselected package libsombok3:amd64. Preparing to unpack .../210-libsombok3_2.4.0-2+b1_amd64.deb ... Unpacking libsombok3:amd64 (2.4.0-2+b1) ... Selecting previously unselected package libstdc++-9-dev:armel. Preparing to unpack .../211-libstdc++-9-dev_9.4.0-1_armel.deb ... Unpacking libstdc++-9-dev:armel (9.4.0-1) ... Selecting previously unselected package libunicode-linebreak-perl. Preparing to unpack .../212-libunicode-linebreak-perl_0.0.20190101-1+b3_amd64.deb ... Unpacking libunicode-linebreak-perl (0.0.20190101-1+b3) ... Selecting previously unselected package xfonts-encodings. Preparing to unpack .../213-xfonts-encodings_1%3a1.0.4-2.1_all.deb ... Unpacking xfonts-encodings (1:1.0.4-2.1) ... Selecting previously unselected package xfonts-utils. Preparing to unpack .../214-xfonts-utils_1%3a7.7+6_amd64.deb ... Unpacking xfonts-utils (1:7.7+6) ... Selecting previously unselected package lmodern. Preparing to unpack .../215-lmodern_2.004.5-6.1_all.deb ... Unpacking lmodern (2.004.5-6.1) ... Selecting previously unselected package texlive-latex-base. Preparing to unpack .../216-texlive-latex-base_2020.20210202-3_all.deb ... Unpacking texlive-latex-base (2020.20210202-3) ... Selecting previously unselected package texlive-luatex. Preparing to unpack .../217-texlive-luatex_2020.20210202-3_all.deb ... Unpacking texlive-luatex (2020.20210202-3) ... Selecting previously unselected package texlive-plain-generic. Preparing to unpack .../218-texlive-plain-generic_2020.20210202-3_all.deb ... Unpacking texlive-plain-generic (2020.20210202-3) ... Selecting previously unselected package texlive-extra-utils. Preparing to unpack .../219-texlive-extra-utils_2020.20210202-3_all.deb ... Unpacking texlive-extra-utils (2020.20210202-3) ... Selecting previously unselected package sbuild-build-depends-main-dummy:armel. Preparing to unpack .../220-sbuild-build-depends-main-dummy_0.invalid.0_armel.deb ... Unpacking sbuild-build-depends-main-dummy:armel (0.invalid.0) ... Setting up libconfig-inifiles-perl (3.000003-1) ... Setting up media-types (4.0.0) ... Setting up libpipeline1:amd64 (1.5.3-1) ... Setting up libgraphite2-3:amd64 (1.3.14-1) ... Setting up liblcms2-2:amd64 (2.12~rc1-2) ... Setting up libpixman-1-0:amd64 (0.40.0-1) ... Setting up libxau6:amd64 (1:1.0.9-1) ... Setting up binutils-arm-linux-gnueabi (2.35.2-2) ... Setting up bsdextrautils (2.36.1-7) ... update-alternatives: using /usr/bin/write.ul to provide /usr/bin/write (write) in auto mode Setting up libicu67:amd64 (67.1-6) ... Setting up libdatrie1:amd64 (0.2.13-1) ... Setting up libmagic-mgc (1:5.39-3) ... Setting up libtexlua53:amd64 (2020.20200327.54578-7) ... Setting up libglib2.0-0:amd64 (2.66.8-1) ... No schema files found: doing nothing. Setting up libijs-0.35:amd64 (0.35-15) ... Setting up perl-modules-5.32 (5.32.1-4) ... Setting up libtexluajit2:amd64 (2020.20200327.54578-7) ... Setting up libbrotli1:amd64 (1.0.9-2+b2) ... Setting up libsqlite3-0:amd64 (3.34.1-3) ... Setting up x11-common (1:7.7+22) ... invoke-rc.d: could not determine current runlevel All runlevel operations denied by policy invoke-rc.d: policy-rc.d denied execution of start. Setting up libmagic1:amd64 (1:5.39-3) ... Setting up libdeflate0:amd64 (1.7-1) ... Setting up linux-libc-dev:armel (5.10.40-1) ... Setting up gettext-base (0.21-4) ... Setting up libzzip-0-13:amd64 (0.13.62-3.3) ... Setting up file (1:5.39-3) ... Setting up libnetpbm10 (2:10.0-15.4) ... Setting up fonts-urw-base35 (20200910-1) ... Setting up gcc-10-arm-linux-gnueabi-base:amd64 (10.2.1-6cross1) ... Setting up libjbig0:amd64 (2.1-3.1+b2) ... Setting up poppler-data (0.4.10-1) ... Setting up linux-libc-dev-armel-cross (5.10.13-1cross4) ... Setting up libosp5 (1.5.2-13+b2) ... Setting up gcc-10-base:armel (10.2.1-6) ... Setting up libfontenc1:amd64 (1:1.1.4-1) ... Setting up autotools-dev (20180224.1+nmu1) ... Setting up libglib2.0-data (2.66.8-1) ... Setting up cross-config (2.6.18+nmu1) ... Setting up libtirpc-dev:amd64 (1.3.1-1) ... Setting up libjpeg62-turbo:amd64 (1:2.0.6-4) ... Setting up libx11-data (2:1.7.1-1) ... Setting up libjbig2dec0:amd64 (0.19-3) ... Setting up libidn11:amd64 (1.33-3) ... Setting up libteckit0:amd64 (2.5.10+ds1-3) ... Setting up libavahi-common-data:amd64 (0.8-5) ... Setting up libdbus-1-3:amd64 (1.12.20-2) ... Setting up libsigsegv2:amd64 (2.13-1) ... Setting up xfonts-encodings (1:1.0.4-2.1) ... Setting up t1utils (1.41-4) ... Setting up libpng16-16:amd64 (1.6.37-3) ... Setting up autopoint (0.21-4) ... Setting up libwebp6:amd64 (0.6.1-2+b1) ... Setting up fonts-dejavu-core (2.37-2) ... Setting up libperl5.32:amd64 (5.32.1-4) ... Setting up gcc-10-cross-base (10.2.1-6cross1) ... Setting up libkpathsea6:amd64 (2020.20200327.54578-7) ... Setting up libc6-armel-cross (2.31-9cross4) ... Setting up libmd0:amd64 (1.0.3-3) ... Setting up libnsl-dev:amd64 (1.3.0-2) ... Setting up sensible-utils (0.0.14) ... Setting up libcrypt-dev:amd64 (1:4.4.18-4) ... Setting up libuchardet0:amd64 (0.0.7-1) ... Setting up libmpdec3:amd64 (2.5.1-2) ... Setting up fonts-lmodern (2.004.5-6.1) ... Setting up libopenjp2-7:amd64 (2.4.0-3) ... Setting up libc6-dev:amd64 (2.31-12) ... Setting up libthai-data (0.1.28-4) ... Setting up sgml-base (1.30) ... Setting up libtiff5:amd64 (4.2.0-1) ... Setting up libjs-jquery (3.5.1+dfsg+~3.5.5-7) ... Setting up libc6-dev-armel-cross (2.31-9cross4) ... Setting up libbsd0:amd64 (0.11.3-1) ... Setting up libelf1:amd64 (0.183-3) ... Setting up readline-common (8.1-2) ... Setting up libxml2:amd64 (2.9.10+dfsg-6.7) ... Setting up xdg-utils (1.1.3-4.1) ... update-alternatives: using /usr/bin/xdg-open to provide /usr/bin/open (open) in auto mode Setting up liblocale-gettext-perl (1.07-4+b1) ... Setting up libsynctex2:amd64 (2020.20200327.54578-7) ... Setting up cpp-10-arm-linux-gnueabi (10.2.1-6cross1) ... Setting up gcc-9-base:armel (9.4.0-1) ... Setting up libgs9-common (9.53.3~dfsg-7) ... Setting up libice6:amd64 (2:1.0.10-1) ... Setting up libxdmcp6:amd64 (1:1.1.2-3) ... Setting up libxcb1:amd64 (1.14-3) ... Setting up gettext (0.21-4) ... Setting up libstdc++-10-dev:amd64 (10.2.1-6) ... Setting up g++-10 (10.2.1-6) ... Setting up libgomp1-armel-cross (10.2.1-6cross1) ... Setting up libtool (2.4.6-15) ... Setting up libxcb-render0:amd64 (1.14-3) ... Setting up libreadline8:amd64 (8.1-2) ... Setting up libgcc-s1-armel-cross (10.2.1-6cross1) ... Setting up libavahi-common3:amd64 (0.8-5) ... Setting up libglib2.0-bin (2.66.8-1) ... Setting up m4 (1.4.18-5) ... Setting up libxcb-shm0:amd64 (1.14-3) ... Setting up opensp (1.5.2-13+b2) ... Setting up libstdc++6-armel-cross (10.2.1-6cross1) ... Setting up libatomic1-armel-cross (10.2.1-6cross1) ... Setting up libthai0:amd64 (0.1.28-4) ... Setting up perl (5.32.1-4) ... Setting up cpp-arm-linux-gnueabi (4:10.2.1-1) ... Setting up libptexenc1:amd64 (2020.20200327.54578-7) ... Setting up libfreetype6:amd64 (2.10.4+dfsg-1) ... Setting up libubsan1-armel-cross (10.2.1-6cross1) ... Setting up ucf (3.0043) ... Setting up netpbm (2:10.0-15.4) ... Setting up libdpkg-perl (1.20.9) ... Setting up autoconf (2.69-14) ... Setting up g++ (4:10.2.1-1) ... update-alternatives: using /usr/bin/g++ to provide /usr/bin/c++ (c++) in auto mode Setting up dwz (0.14-1) ... Setting up groff-base (1.22.4-6) ... Setting up libmime-charset-perl (1.012.2-1) ... Setting up xml-core (0.18+nmu1) ... Setting up libsub-override-perl (0.09-2) ... Setting up libx11-6:amd64 (2:1.7.1-1) ... Setting up libharfbuzz0b:amd64 (2.7.4-1) ... Setting up libsm6:amd64 (2:1.2.3-1) ... Setting up libavahi-client3:amd64 (0.8-5) ... Setting up libasan6-armel-cross (10.2.1-6cross1) ... Setting up libpython3.9-stdlib:amd64 (3.9.2-1) ... Setting up libpython3-stdlib:amd64 (3.9.2-3) ... Setting up automake (1:1.16.3-2) ... update-alternatives: using /usr/bin/automake-1.16 to provide /usr/bin/automake (automake) in auto mode Setting up libpaper1:amd64 (1.1.28+b1) ... Creating config file /etc/papersize with new version Setting up libfile-which-perl (1.23-1) ... Setting up libxpm4:amd64 (1:3.5.12-1) ... Setting up libxrender1:amd64 (1:0.9.10-1) ... Setting up libsombok3:amd64 (2.4.0-2+b1) ... Setting up libarchive-zip-perl (1.68-1) ... Setting up fontconfig-config (2.13.1-4.2) ... Setting up libgcc-10-dev-armel-cross (10.2.1-6cross1) ... Setting up libdebhelper-perl (13.3.4) ... Setting up libxext6:amd64 (2:1.3.3-1.1) ... Setting up libxml-namespacesupport-perl (1.12-1.1) ... Setting up libpaper-utils (1.1.28+b1) ... Setting up xfonts-utils (1:7.7+6) ... Setting up man-db (2.9.4-2) ... Not building database; man-db/auto-update is not 'true'. Setting up libyaml-perl (1.30-1) ... Setting up dpkg-dev (1.20.9) ... Setting up intltool-debian (0.35.0+20060710.5) ... Setting up dh-autoreconf (20) ... Setting up tex-common (6.16) ... update-language: texlive-base not installed and configured, doing nothing! Setting up libxml-sax-base-perl (1.09-1.1) ... Setting up libio-string-perl (1.08-3.1) ... Setting up libunicode-linebreak-perl (0.0.20190101-1+b3) ... Setting up pkg-config (0.29.2-1) ... Setting up libxt6:amd64 (1:1.2.0-1) ... Setting up libcups2:amd64 (2.3.3op2-3+deb11u1) ... Setting up lmodern (2.004.5-6.1) ... Setting up build-essential (12.9) ... Setting up libfontconfig1:amd64 (2.13.1-4.2) ... Setting up libfile-homedir-perl (1.006-1) ... Setting up python3.9 (3.9.2-1) ... Setting up gcc-10-arm-linux-gnueabi (10.2.1-6cross1) ... Setting up libfile-stripnondeterminism-perl (1.12.0-1) ... Setting up libxmu6:amd64 (2:1.1.2-2+b3) ... Setting up libstdc++-10-dev-armel-cross (10.2.1-6cross1) ... Setting up libgs9:amd64 (9.53.3~dfsg-7) ... Setting up libxi6:amd64 (2:1.7.10-1) ... Setting up po-debconf (1.0.21+nmu1) ... Setting up python3 (3.9.2-3) ... Setting up libxaw7:amd64 (2:1.0.13-1.1) ... Setting up ghostscript (9.53.3~dfsg-7) ... Setting up libxml-sax-perl (1.02+dfsg-1) ... update-perl-sax-parsers: Registering Perl SAX parser XML::SAX::PurePerl with priority 10... update-perl-sax-parsers: Updating overall Perl SAX parser modules info file... Creating config file /etc/perl/XML/SAX/ParserDetails.ini with new version Setting up libcairo2:amd64 (1.16.0-5) ... Setting up libxml-libxml-perl (2.0134+dfsg-2+b1) ... update-perl-sax-parsers: Registering Perl SAX parser XML::LibXML::SAX::Parser with priority 50... update-perl-sax-parsers: Registering Perl SAX parser XML::LibXML::SAX with priority 50... update-perl-sax-parsers: Updating overall Perl SAX parser modules info file... Replacing config file /etc/perl/XML/SAX/ParserDetails.ini with new version Setting up dh-strip-nondeterminism (1.12.0-1) ... Setting up texlive-binaries (2020.20200327.54578-7) ... update-alternatives: using /usr/bin/xdvi-xaw to provide /usr/bin/xdvi.bin (xdvi.bin) in auto mode update-alternatives: using /usr/bin/bibtex.original to provide /usr/bin/bibtex (bibtex) in auto mode Setting up gcc-arm-linux-gnueabi (4:10.2.1-1) ... Setting up g++-10-arm-linux-gnueabi (10.2.1-6cross1) ... Setting up python3-lib2to3 (3.9.2-1) ... Setting up texlive-base (2020.20210202-3) ... tl-paper: setting paper size for dvips to a4: /var/lib/texmf/dvips/config/config-paper.ps tl-paper: setting paper size for dvipdfmx to a4: /var/lib/texmf/dvipdfmx/dvipdfmx-paper.cfg tl-paper: setting paper size for xdvi to a4: /var/lib/texmf/xdvi/XDvi-paper tl-paper: setting paper size for pdftex to a4: /var/lib/texmf/tex/generic/tex-ini-files/pdftexconfig.tex Setting up python3-distutils (3.9.2-1) ... Setting up libglib2.0-dev-bin (2.66.8-1) ... Setting up texlive-luatex (2020.20210202-3) ... Setting up texlive-plain-generic (2020.20210202-3) ... Setting up debhelper (13.3.4) ... Setting up g++-arm-linux-gnueabi (4:10.2.1-1) ... Setting up texlive-latex-base (2020.20210202-3) ... Setting up texlive-extra-utils (2020.20210202-3) ... Setting up libxml-simple-perl (2.25-1) ... Setting up hevea (2.34-2+b1) ... Setting up libconfig-auto-perl (0.44-1.1) ... Setting up libdebian-dpkgcross-perl (2.6.18+nmu1) ... Setting up dpkg-cross (2.6.18+nmu1) ... Setting up crossbuild-essential-armel (12.9) ... Setting up libcrypt1:armel (1:4.4.18-4) ... Setting up libgcc-s1:armel (10.2.1-6) ... Setting up libc6:armel (2.31-12) ... Setting up libsepol1:armel (3.1-1) ... Setting up libcrypt-dev:armel (1:4.4.18-4) ... Setting up libblkid1:armel (2.36.1-7) ... Setting up libstdc++6:armel (10.2.1-6) ... Setting up libkeyutils1:armel (1.6.1-2) ... Setting up libpcre16-3:armel (2:8.39-13) ... Setting up libssl1.1:armel (1.1.1k-1) ... Setting up libffi7:armel (3.3-6) ... Setting up libsepol1-dev:armel (3.1-1) ... Setting up zlib1g:armel (1:1.2.11.dfsg-2) ... Setting up libcom-err2:armel (1.46.2-1) ... Setting up libgomp1:armel (10.2.1-6) ... Setting up libffi-dev:armel (3.3-6) ... Setting up libpcre2-16-0:armel (10.36-2) ... Setting up libkrb5support0:armel (1.18.3-5) ... Setting up libasan5:armel (9.4.0-1) ... Setting up libpcre3:armel (2:8.39-13) ... Setting up libpcre2-32-0:armel (10.36-2) ... Setting up libpcre32-3:armel (2:8.39-13) ... Setting up libatomic1:armel (10.2.1-6) ... Setting up libuuid1:armel (2.36.1-7) ... Setting up libpcre2-8-0:armel (10.36-2) ... Setting up libk5crypto3:armel (1.18.3-5) ... Setting up libubsan1:armel (10.2.1-6) ... Setting up libkrb5-3:armel (1.18.3-5) ... Setting up libpcrecpp0v5:armel (2:8.39-13) ... Setting up libgcc-9-dev:armel (9.4.0-1) ... Setting up libselinux1:armel (3.1-3) ... Setting up libgssapi-krb5-2:armel (1.18.3-5) ... Setting up libpcre2-posix2:armel (10.36-2) ... Setting up libmount1:armel (2.36.1-7) ... Setting up libtirpc3:armel (1.3.1-1) ... Setting up libglib2.0-0:armel (2.66.8-1) ... /var/lib/dpkg/info/libglib2.0-0:armel.postinst: 62: /usr/lib/arm-linux-gnueabi/glib-2.0/glib-compile-schemas: Exec format error /var/lib/dpkg/info/libglib2.0-0:armel.postinst: 65: /usr/lib/arm-linux-gnueabi/glib-2.0/gio-querymodules: Exec format error Setting up libtirpc-dev:armel (1.3.1-1) ... Setting up libnsl2:armel (1.3.0-2) ... Setting up libnsl-dev:armel (1.3.0-2) ... Setting up libc6-dev:armel (2.31-12) ... Setting up libstdc++-9-dev:armel (9.4.0-1) ... Setting up libpcre2-dev:armel (10.36-2) ... Setting up libselinux1-dev:armel (3.1-3) ... Setting up libpcre3-dev:armel (2:8.39-13) ... Setting up uuid-dev:armel (2.36.1-7) ... Setting up zlib1g-dev:armel (1:1.2.11.dfsg-2) ... Setting up libblkid-dev:armel (2.36.1-7) ... Setting up libmount-dev:armel (2.36.1-7) ... Setting up libglib2.0-dev:armel (2.66.8-1) ... Processing triggers for libc-bin (2.31-12) ... Processing triggers for sgml-base (1.30) ... Setting up sgml-data (2.0.11+nmu1) ... Processing triggers for sgml-base (1.30) ... Setting up docbook (4.5-6) ... Processing triggers for sgml-base (1.30) ... Setting up docbook-to-man (1:2.0.0-45) ... Setting up sbuild-build-depends-main-dummy:armel (0.invalid.0) ... Processing triggers for tex-common (6.16) ... Running updmap-sys. This may take some time... done. Running mktexlsr /var/lib/texmf ... done. Building format(s) --all. This may take some time... done. +------------------------------------------------------------------------------+ | Check architectures | +------------------------------------------------------------------------------+ Arch check ok (armel included in any all) +------------------------------------------------------------------------------+ | Build environment | +------------------------------------------------------------------------------+ Kernel: Linux 4.19.0-16-amd64 #1 SMP Debian 4.19.181-1 (2021-03-19) amd64 (x86_64) Toolchain package versions: binutils_2.35.2-2 dpkg-dev_1.20.9 g++-10_10.2.1-6 gcc-10_10.2.1-6 libc6-dev_2.31-12 libstdc++-10-dev_10.2.1-6 libstdc++-10-dev-armel-cross_10.2.1-6cross1 libstdc++-9-dev_9.4.0-1 libstdc++6_10.2.1-6 libstdc++6-armel-cross_10.2.1-6cross1 linux-libc-dev_5.10.40-1 Package versions: adduser_3.118 apt_2.2.3 autoconf_2.69-14 automake_1:1.16.3-2 autopoint_0.21-4 autotools-dev_20180224.1+nmu1 base-files_11.1 base-passwd_3.5.50 bash_5.1-3 binutils_2.35.2-2 binutils-arm-linux-gnueabi_2.35.2-2 binutils-common_2.35.2-2 binutils-x86-64-linux-gnu_2.35.2-2 bsdextrautils_2.36.1-7 bsdutils_1:2.36.1-7 build-essential_12.9 bzip2_1.0.8-4 coreutils_8.32-4+b1 cpp_4:10.2.1-1 cpp-10_10.2.1-6 cpp-10-arm-linux-gnueabi_10.2.1-6cross1 cpp-8_8.4.0-7 cpp-arm-linux-gnueabi_4:10.2.1-1 cross-config_2.6.18+nmu1 crossbuild-essential-armel_12.9 dash_0.5.11+git20210120+802ebd4-1 debconf_1.5.76 debhelper_13.3.4 debian-archive-keyring_2021.1.1 debianutils_4.11.2 dh-autoreconf_20 dh-strip-nondeterminism_1.12.0-1 diffutils_1:3.7-5 docbook_4.5-6 docbook-to-man_1:2.0.0-45 dpkg_1.20.9 dpkg-cross_2.6.18+nmu1 dpkg-dev_1.20.9 dwz_0.14-1 e2fsprogs_1.46.2-1 fakeroot_1.25.3-1.1 fdisk_2.36.1-7 file_1:5.39-3 findutils_4.8.0-1 fontconfig-config_2.13.1-4.2 fonts-dejavu-core_2.37-2 fonts-lmodern_2.004.5-6.1 fonts-urw-base35_20200910-1 g++_4:10.2.1-1 g++-10_10.2.1-6 g++-10-arm-linux-gnueabi_10.2.1-6cross1 g++-arm-linux-gnueabi_4:10.2.1-1 gcc_4:10.2.1-1 gcc-10_10.2.1-6 gcc-10-arm-linux-gnueabi_10.2.1-6cross1 gcc-10-arm-linux-gnueabi-base_10.2.1-6cross1 gcc-10-base_10.2.1-6 gcc-10-cross-base_10.2.1-6cross1 gcc-8-base_8.4.0-7 gcc-9-base_9.4.0-1 gcc-arm-linux-gnueabi_4:10.2.1-1 gettext_0.21-4 gettext-base_0.21-4 ghostscript_9.53.3~dfsg-7 gpgv_2.2.27-2 grep_3.6-1 groff-base_1.22.4-6 gzip_1.10-4 hevea_2.34-2+b1 hostname_3.23 init-system-helpers_1.60 intltool-debian_0.35.0+20060710.5 libacl1_2.2.53-10 libapt-pkg5.0_1.8.4 libapt-pkg6.0_2.2.3 libarchive-zip-perl_1.68-1 libasan5_9.4.0-1 libasan6_10.2.1-6 libasan6-armel-cross_10.2.1-6cross1 libatomic1_10.2.1-6 libatomic1-armel-cross_10.2.1-6cross1 libattr1_1:2.4.48-6 libaudit-common_1:3.0-2 libaudit1_1:3.0-2 libavahi-client3_0.8-5 libavahi-common-data_0.8-5 libavahi-common3_0.8-5 libbinutils_2.35.2-2 libblkid-dev_2.36.1-7 libblkid1_2.36.1-7 libbrotli1_1.0.9-2+b2 libbsd0_0.11.3-1 libbz2-1.0_1.0.8-4 libc-bin_2.31-12 libc-dev-bin_2.31-12 libc6_2.31-12 libc6-armel-cross_2.31-9cross4 libc6-dev_2.31-12 libc6-dev-armel-cross_2.31-9cross4 libcairo2_1.16.0-5 libcap-ng0_0.7.9-2.2+b1 libcc1-0_10.2.1-6 libcom-err2_1.46.2-1 libconfig-auto-perl_0.44-1.1 libconfig-inifiles-perl_3.000003-1 libcrypt-dev_1:4.4.18-4 libcrypt1_1:4.4.18-4 libctf-nobfd0_2.35.2-2 libctf0_2.35.2-2 libcups2_2.3.3op2-3+deb11u1 libdatrie1_0.2.13-1 libdb5.3_5.3.28+dfsg1-0.8 libdbus-1-3_1.12.20-2 libdebconfclient0_0.259 libdebhelper-perl_13.3.4 libdebian-dpkgcross-perl_2.6.18+nmu1 libdeflate0_1.7-1 libdpkg-perl_1.20.9 libelf1_0.183-3 libexpat1_2.2.10-2 libext2fs2_1.46.2-1 libfakeroot_1.25.3-1.1 libfdisk1_2.36.1-7 libffi-dev_3.3-6 libffi6_3.2.1-9 libffi7_3.3-6 libfile-homedir-perl_1.006-1 libfile-stripnondeterminism-perl_1.12.0-1 libfile-which-perl_1.23-1 libfontconfig1_2.13.1-4.2 libfontenc1_1:1.1.4-1 libfreetype6_2.10.4+dfsg-1 libgcc-10-dev_10.2.1-6 libgcc-10-dev-armel-cross_10.2.1-6cross1 libgcc-9-dev_9.4.0-1 libgcc-s1_10.2.1-6 libgcc-s1-armel-cross_10.2.1-6cross1 libgcrypt20_1.8.7-6 libgdbm-compat4_1.19-2 libgdbm6_1.19-2 libglib2.0-0_2.66.8-1 libglib2.0-bin_2.66.8-1 libglib2.0-data_2.66.8-1 libglib2.0-dev_2.66.8-1 libglib2.0-dev-bin_2.66.8-1 libgmp10_2:6.2.1+dfsg-1 libgnutls30_3.7.1-5 libgomp1_10.2.1-6 libgomp1-armel-cross_10.2.1-6cross1 libgpg-error0_1.38-2 libgraphite2-3_1.3.14-1 libgs9_9.53.3~dfsg-7 libgs9-common_9.53.3~dfsg-7 libgssapi-krb5-2_1.18.3-5 libharfbuzz0b_2.7.4-1 libhogweed4_3.5.1+really3.4.1-1 libhogweed6_3.7.2-3 libice6_2:1.0.10-1 libicu67_67.1-6 libidn11_1.33-3 libidn2-0_2.3.0-5 libijs-0.35_0.35-15 libio-string-perl_1.08-3.1 libisl19_0.20-2 libisl23_0.23-1 libitm1_10.2.1-6 libjbig0_2.1-3.1+b2 libjbig2dec0_0.19-3 libjpeg62-turbo_1:2.0.6-4 libjs-jquery_3.5.1+dfsg+~3.5.5-7 libk5crypto3_1.18.3-5 libkeyutils1_1.6.1-2 libkpathsea6_2020.20200327.54578-7 libkrb5-3_1.18.3-5 libkrb5support0_1.18.3-5 liblcms2-2_2.12~rc1-2 liblocale-gettext-perl_1.07-4+b1 liblsan0_10.2.1-6 liblz4-1_1.9.3-2 liblzma5_5.2.5-2 libmagic-mgc_1:5.39-3 libmagic1_1:5.39-3 libmd0_1.0.3-3 libmime-charset-perl_1.012.2-1 libmount-dev_2.36.1-7 libmount1_2.36.1-7 libmpc3_1.2.0-1 libmpdec3_2.5.1-2 libmpfr6_4.1.0-3 libmpx2_8.4.0-7 libncursesw6_6.2+20201114-2 libnetpbm10_2:10.0-15.4 libnettle6_3.5.1+really3.4.1-1 libnettle8_3.7.2-3 libnsl-dev_1.3.0-2 libnsl2_1.3.0-2 libopenjp2-7_2.4.0-3 libosp5_1.5.2-13+b2 libp11-kit0_0.23.22-1 libpam-modules_1.4.0-7 libpam-modules-bin_1.4.0-7 libpam-runtime_1.4.0-7 libpam0g_1.4.0-7 libpaper-utils_1.1.28+b1 libpaper1_1.1.28+b1 libpcre16-3_2:8.39-13 libpcre2-16-0_10.36-2 libpcre2-32-0_10.36-2 libpcre2-8-0_10.36-2 libpcre2-dev_10.36-2 libpcre2-posix2_10.36-2 libpcre3_2:8.39-13 libpcre3-dev_2:8.39-13 libpcre32-3_2:8.39-13 libpcrecpp0v5_2:8.39-13 libperl5.28_5.28.1-6 libperl5.32_5.32.1-4 libpipeline1_1.5.3-1 libpixman-1-0_0.40.0-1 libpng16-16_1.6.37-3 libptexenc1_2020.20200327.54578-7 libpython3-stdlib_3.9.2-3 libpython3.9-minimal_3.9.2-1 libpython3.9-stdlib_3.9.2-1 libquadmath0_10.2.1-6 libreadline8_8.1-2 libseccomp2_2.5.1-1 libselinux1_3.1-3 libselinux1-dev_3.1-3 libsemanage-common_3.1-1 libsemanage1_3.1-1+b2 libsepol1_3.1-1 libsepol1-dev_3.1-1 libsigsegv2_2.13-1 libsm6_2:1.2.3-1 libsmartcols1_2.36.1-7 libsombok3_2.4.0-2+b1 libsqlite3-0_3.34.1-3 libss2_1.46.2-1 libssl1.1_1.1.1k-1 libstdc++-10-dev_10.2.1-6 libstdc++-10-dev-armel-cross_10.2.1-6cross1 libstdc++-9-dev_9.4.0-1 libstdc++6_10.2.1-6 libstdc++6-armel-cross_10.2.1-6cross1 libsub-override-perl_0.09-2 libsynctex2_2020.20200327.54578-7 libsystemd0_247.3-5 libtasn1-6_4.16.0-2 libteckit0_2.5.10+ds1-3 libtexlua53_2020.20200327.54578-7 libtexluajit2_2020.20200327.54578-7 libthai-data_0.1.28-4 libthai0_0.1.28-4 libtiff5_4.2.0-1 libtinfo6_6.2+20201114-2 libtirpc-common_1.3.1-1 libtirpc-dev_1.3.1-1 libtirpc3_1.3.1-1 libtool_2.4.6-15 libtsan0_10.2.1-6 libubsan1_10.2.1-6 libubsan1-armel-cross_10.2.1-6cross1 libuchardet0_0.0.7-1 libudev1_247.3-5 libunicode-linebreak-perl_0.0.20190101-1+b3 libunistring2_0.9.10-4 libuuid1_2.36.1-7 libwebp6_0.6.1-2+b1 libx11-6_2:1.7.1-1 libx11-data_2:1.7.1-1 libxau6_1:1.0.9-1 libxaw7_2:1.0.13-1.1 libxcb-render0_1.14-3 libxcb-shm0_1.14-3 libxcb1_1.14-3 libxdmcp6_1:1.1.2-3 libxext6_2:1.3.3-1.1 libxi6_2:1.7.10-1 libxml-libxml-perl_2.0134+dfsg-2+b1 libxml-namespacesupport-perl_1.12-1.1 libxml-sax-base-perl_1.09-1.1 libxml-sax-perl_1.02+dfsg-1 libxml-simple-perl_2.25-1 libxml2_2.9.10+dfsg-6.7 libxmu6_2:1.1.2-2+b3 libxpm4_1:3.5.12-1 libxrender1_1:0.9.10-1 libxt6_1:1.2.0-1 libxxhash0_0.8.0-2 libyaml-perl_1.30-1 libzstd1_1.4.8+dfsg-2.1 libzzip-0-13_0.13.62-3.3 linux-libc-dev_5.10.40-1 linux-libc-dev-armel-cross_5.10.13-1cross4 lmodern_2.004.5-6.1 login_1:4.8.1-1 logsave_1.46.2-1 lsb-base_11.1.0 m4_1.4.18-5 make_4.3-4.1 man-db_2.9.4-2 mawk_1.3.4.20200120-2 media-types_4.0.0 mount_2.36.1-7 ncurses-base_6.2+20201114-2 ncurses-bin_6.2+20201114-2 netpbm_2:10.0-15.4 opensp_1.5.2-13+b2 passwd_1:4.8.1-1 patch_2.7.6-7 perl_5.32.1-4 perl-base_5.32.1-4 perl-modules-5.28_5.28.1-6 perl-modules-5.32_5.32.1-4 pkg-config_0.29.2-1 po-debconf_1.0.21+nmu1 poppler-data_0.4.10-1 python3_3.9.2-3 python3-distutils_3.9.2-1 python3-lib2to3_3.9.2-1 python3-minimal_3.9.2-3 python3.9_3.9.2-1 python3.9-minimal_3.9.2-1 readline-common_8.1-2 sbuild-build-depends-main-dummy_0.invalid.0 sed_4.7-1 sensible-utils_0.0.14 sgml-base_1.30 sgml-data_2.0.11+nmu1 sysvinit-utils_2.96-7 t1utils_1.41-4 tar_1.34+dfsg-1 tex-common_6.16 texlive-base_2020.20210202-3 texlive-binaries_2020.20200327.54578-7 texlive-extra-utils_2020.20210202-3 texlive-latex-base_2020.20210202-3 texlive-luatex_2020.20210202-3 texlive-plain-generic_2020.20210202-3 tzdata_2021a-1 ucf_3.0043 util-linux_2.36.1-7 uuid-dev_2.36.1-7 x11-common_1:7.7+22 xdg-utils_1.1.3-4.1 xfonts-encodings_1:1.0.4-2.1 xfonts-utils_1:7.7+6 xml-core_0.18+nmu1 xz-utils_5.2.5-2 zlib1g_1:1.2.11.dfsg-2 zlib1g-dev_1:1.2.11.dfsg-2 +------------------------------------------------------------------------------+ | Build | +------------------------------------------------------------------------------+ Unpack source ------------- -----BEGIN PGP SIGNED MESSAGE----- Hash: SHA512 Format: 3.0 (quilt) Source: wise Binary: wise, wise-doc, wise-data Architecture: any all Version: 2.4.1-23 Maintainer: Debian Med Packaging Team Uploaders: Steffen Moeller , Charles Plessy , Andreas Tille Homepage: https://www.ebi.ac.uk/~birney/wise2/ Standards-Version: 4.5.0 Vcs-Browser: https://salsa.debian.org/med-team/wise Vcs-Git: https://salsa.debian.org/med-team/wise.git Testsuite: autopkgtest Build-Depends: debhelper-compat (= 12), texlive-latex-base, texlive-extra-utils, hevea, docbook-to-man, libglib2.0-dev Package-List: wise deb science optional arch=any wise-data deb doc optional arch=all wise-doc deb doc optional arch=all Checksums-Sha1: 50215e0541ed043d2ee44463da1b1a0d5272d724 3410178 wise_2.4.1.orig.tar.gz 3a0b88d342fb1b6ac2ee20ced2dcbcdf44795439 27152 wise_2.4.1-23.debian.tar.xz Checksums-Sha256: 0aec5e30739110783517a429606249fc6c5fd0d65171c1a6d79ecc5ff81d2935 3410178 wise_2.4.1.orig.tar.gz 432297bafe4688cd3f3041e5d8897792ef1b7cd3afb7bef3d06274abf28d7772 27152 wise_2.4.1-23.debian.tar.xz Files: 9e90132c19a653831ce63b5af7f08302 3410178 wise_2.4.1.orig.tar.gz 55b2719ab85acb83f518de3c19708e95 27152 wise_2.4.1-23.debian.tar.xz -----BEGIN PGP SIGNATURE----- iQJFBAEBCgAvFiEE8fAHMgoDVUHwpmPKV4oElNHGRtEFAl6bJzMRHHRpbGxlQGRl Ymlhbi5vcmcACgkQV4oElNHGRtHl8Q//SYLAoXInTt3fiR2c5KDeaDzjnrsuW6MZ sUvYH9VA9f0kUA5avHcQ2GU82pZoDKRxWRW4xmLhOqUDMCfCkAnah44RDWPQeBLE lPGK1U8zn0P+XI1dWZuEtjfRuYKJwjzcAGOd0AqONrzFfzxfpc9ug1RvC0ERl/5R wBGZ6dUcjJ3uDK4klKPCVtSg6WBq+/fcCTYJiepxW0I7y1mbT70nJXuNnWtevqcV ifhlJuihR8N20fOobQM8uVhcDAFc8xqsgsc1022qhW3Lh1YR4r3hy3O849K7JG5b xt9Fj6AtHhLWwsoV2g6/k8kTrlhT4e48BwFnHaV3POGRyNfMjil5MAdomF7uOP9Q HJ8w+tmliP+ItPD24FXESngPQQtz6wMjtMC1rIFWEkznIxJW8gGfEwm78hWsP8Tz nsJT6F1s6AhXgSq5O713EY3jYDOazav59KwFPzlllOhKyO5u+Fd+M0D1SZa+XfnG GHc3fCdVoeUItIbM0nAXqMWJe4XoZiL8aTSu31Qez2UvvnFPIlv0dAXpw6+KvBzA iYR3fsQB/Ger5nXUGXed8U6G9dYKMdAToP6iBLp3L4zpc6CPNKahReiYg5VKzoC+ +NlYUFB7wjKcFBnW/Kkc7d53aHdFPHJASZfAGEIO7RjgaUqafOYhL8N4QnJSw5KI REUWZmItrSU= =K6w+ -----END PGP SIGNATURE----- gpgv: unknown type of key resource 'trustedkeys.kbx' gpgv: keyblock resource '/tmp/dpkg-verify-sig.Kq2kMoIe/trustedkeys.kbx': General error gpgv: Signature made Sat Apr 18 16:13:39 2020 UTC gpgv: using RSA key F1F007320A035541F0A663CA578A0494D1C646D1 gpgv: issuer "tille@debian.org" gpgv: Can't check signature: No public key dpkg-source: warning: failed to verify signature on ./wise_2.4.1-23.dsc dpkg-source: info: extracting wise in /<> dpkg-source: info: unpacking wise_2.4.1.orig.tar.gz dpkg-source: info: unpacking wise_2.4.1-23.debian.tar.xz dpkg-source: info: using patch list from debian/patches/series dpkg-source: info: applying 01_welcome-csh.patch dpkg-source: info: applying 02_isnumber.patch dpkg-source: info: applying 03_doc-nodycache.patch dpkg-source: info: applying 04_wise2-pdflatex-update.patch dpkg-source: info: applying 05_glib2.patch dpkg-source: info: applying 06_getline.patch dpkg-source: info: applying 07_ld--as-needed.patch dpkg-source: info: applying 08_mayhem.patch dpkg-source: info: applying 09_dnal-add-return-statement.patch dpkg-source: info: applying 10_fix_path_to_data_files.patch dpkg-source: info: applying 11_consistent_manual_dates.patch dpkg-source: info: applying spelling.patch dpkg-source: info: applying cross.patch Check disk space ---------------- Sufficient free space for build User Environment ---------------- APT_CONFIG=/var/lib/sbuild/apt.conf CONFIG_SITE=/etc/dpkg-cross/cross-config.armel DEB_BUILD_OPTIONS=nocheck HOME=/sbuild-nonexistent LANG=en_US.UTF-8 LC_ALL=C.UTF-8 LOGNAME=helmut PATH=/usr/local/sbin:/usr/local/bin:/usr/sbin:/usr/bin:/sbin:/bin:/usr/games SCHROOT_ALIAS_NAME=unstable-amd64-sbuild SCHROOT_CHROOT_NAME=unstable-amd64-sbuild SCHROOT_COMMAND=env SCHROOT_GID=1003 SCHROOT_GROUP=helmut SCHROOT_SESSION_ID=unstable-amd64-sbuild-8061ed78-5a4f-432b-83fc-325d707702dc SCHROOT_UID=1003 SCHROOT_USER=helmut SHELL=/bin/sh USER=helmut dpkg-buildpackage ----------------- Command: dpkg-buildpackage -aarmel -Pcross,nocheck -us -uc -B -rfakeroot --jobs-try=1 dpkg-buildpackage: info: source package wise dpkg-buildpackage: info: source version 2.4.1-23 dpkg-buildpackage: info: source distribution unstable dpkg-buildpackage: info: source changed by Helmut Grohne dpkg-architecture: warning: specified GNU system type arm-linux-gnueabi does not match CC system type x86_64-linux-gnu, try setting a correct CC environment variable dpkg-source --before-build . dpkg-buildpackage: info: host architecture armel debian/rules clean dh clean debian/rules override_dh_clean make[1]: Entering directory '/<>' /usr/bin/make -C src clean make[2]: Entering directory '/<>/src' cd external ; /usr/bin/make clean make[3]: Entering directory '/<>/src/external' (cd mott; make clean) make[4]: Entering directory '/<>/src/external/mott' rm -f *.[oa] make[4]: Leaving directory '/<>/src/external/mott' make[3]: Leaving directory '/<>/src/external' if test -d dynlibsrc; then cd dynlibsrc ; rm -f *.[oa]; fi if test -d models; then cd models ; rm -f *.[oa]; fi if test -d base; then cd base ; rm -f *.[oa]; fi if test -d socket; then cd socket ; rm -f *.[oa]; fi if test -d dnaindex; then cd dnaindex ; rm -f *.[oa]; fi if test -d network; then cd network ; rm -f *.[oa]; fi if test -d dyc; then cd dyc ; rm -f *.[oa]; fi if test -d HMMer2; then cd HMMer2 ; rm -f *.[oa]; fi if test -d perl; then cd perl/Wise2/libs ; rm -f *.[oa]; fi if test -x perl/Wise2/Makefile; then cd perl/Wise2/ ; /usr/bin/make clean; fi if test -d oldbin; then rm -rf oldbin; fi if test -d bin; then echo 'moving binaries to oldbin'; mv -f bin oldbin; fi make[2]: Leaving directory '/<>/src' /usr/bin/make -C debian/manpages.d clean make[2]: Entering directory '/<>/debian/manpages.d' rm -f dba.1 dnal.1 estwise.1 estwisedb.1 genewise.1 genewisedb.1 genomewise.1 promoterwise.1 psw.1 pswdb.1 scanwise.1 scanwise_server.1 make[2]: Leaving directory '/<>/debian/manpages.d' rm -f -r src/oldbin for i in dba psw dnal genomewise pswdb scanwise estwise genewise sywise genewisedb promoterwise pseudowise estwisedb; do rm -f src/models/$i; done rm -f src/network/scanwise_server rm -f docs/temp.tex rm -f docs/api.* rm -f docs/wise2.image.tex rm -f docs/*.pdf rm -f docs/*.aux rm -f docs/*.log rm -f docs/*.toc rm -f docs/*.pdf rm -f docs/*.dvi rm -f docs/*.ps rm -f docs/*.4ct rm -f docs/*.4tc rm -f docs/*.css rm -f docs/*.idv rm -f docs/*.lg rm -f docs/*.tmp rm -f docs/*.xref rm -f docs/*.haux rm -f docs/*.htoc rm -f docs/*.html rm -f -r docs/api rm -f -r docs/dynamite rm -f -r docs/wise2 dh_clean rm -f debian/debhelper-build-stamp rm -rf debian/.debhelper/ rm -f -- debian/wise.substvars debian/wise-doc.substvars debian/wise-data.substvars debian/files rm -fr -- debian/wise/ debian/tmp/ debian/wise-doc/ debian/wise-data/ find . \( \( \ \( -path .\*/.git -o -path .\*/.svn -o -path .\*/.bzr -o -path .\*/.hg -o -path .\*/CVS -o -path .\*/.pc -o -path .\*/_darcs \) -prune -o -type f -a \ \( -name '#*#' -o -name '.*~' -o -name '*~' -o -name DEADJOE \ -o -name '*.orig' -o -name '*.rej' -o -name '*.bak' \ -o -name '.*.orig' -o -name .*.rej -o -name '.SUMS' \ -o -name TAGS -o \( -path '*/.deps/*' -a -name '*.P' \) \ \) -exec rm -f {} + \) -o \ \( -type d -a -name autom4te.cache -prune -exec rm -rf {} + \) \) make[1]: Leaving directory '/<>' debian/rules binary-arch dh binary-arch dh_update_autotools_config -a dh_autoreconf -a debian/rules override_dh_auto_build make[1]: Entering directory '/<>' dh_auto_build --sourcedirectory=src -- all cd src && make -j1 "INSTALL=install --strip-program=true" PKG_CONFIG=arm-linux-gnueabi-pkg-config CXX=arm-linux-gnueabi-g\+\+ CC=arm-linux-gnueabi-gcc all make[2]: Entering directory '/<>/src' (cd base ; make CC="arm-linux-gnueabi-gcc" CFLAGS="-g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c `arm-linux-gnueabi-pkg-config --cflags glib-2.0`" libwisebase.a ) make[3]: Entering directory '/<>/src/base' arm-linux-gnueabi-gcc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/arm-linux-gnueabi/glib-2.0/include wiseconfig.c arm-linux-gnueabi-gcc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/arm-linux-gnueabi/glib-2.0/include wisestring.c arm-linux-gnueabi-gcc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/arm-linux-gnueabi/glib-2.0/include wiseerror.c arm-linux-gnueabi-gcc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/arm-linux-gnueabi/glib-2.0/include wisememman.c arm-linux-gnueabi-gcc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/arm-linux-gnueabi/glib-2.0/include wisefile.c wisefile.dy: In function ‘Wise2_myfclose’: wisefile.dy:72:18: warning: format ‘%d’ expects argument of type ‘int’, but argument 3 has type ‘FILE *’ [-Wformat=] 72 | fprintf(stderr,"Closing %d\n",ofp); | ^~~~~~~~~~~~~~ ~~~ | | | FILE * arm-linux-gnueabi-gcc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/arm-linux-gnueabi/glib-2.0/include wiserandom.c arm-linux-gnueabi-gcc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/arm-linux-gnueabi/glib-2.0/include wisetime.c arm-linux-gnueabi-gcc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/arm-linux-gnueabi/glib-2.0/include wiseoverlay.c arm-linux-gnueabi-gcc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/arm-linux-gnueabi/glib-2.0/include wisestreaminterface.c arm-linux-gnueabi-gcc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/arm-linux-gnueabi/glib-2.0/include commandline.c arm-linux-gnueabi-gcc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/arm-linux-gnueabi/glib-2.0/include linesubs.c ar ru libwisebase.a wiseconfig.o wisestring.o wiseerror.o wisememman.o wisefile.o wiserandom.o wisetime.o wiseoverlay.o wisestreaminterface.o commandline.o linesubs.o ar: `u' modifier ignored since `D' is the default (see `U') ar: creating libwisebase.a if test -x /bin/ranlib; then /bin/ranlib libwisebase.a; else exit 0; fi if test -x /usr/bin/ranlib; then /usr/bin/ranlib libwisebase.a; else exit 0; fi make[3]: Leaving directory '/<>/src/base' (cd HMMer2 ; make CC="arm-linux-gnueabi-gcc" CFLAGS="-g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c `arm-linux-gnueabi-pkg-config --cflags glib-2.0`" libhmmer.a ) make[3]: Entering directory '/<>/src/HMMer2' arm-linux-gnueabi-gcc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/arm-linux-gnueabi/glib-2.0/include -c alphabet.c arm-linux-gnueabi-gcc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/arm-linux-gnueabi/glib-2.0/include -c core_algorithms.c arm-linux-gnueabi-gcc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/arm-linux-gnueabi/glib-2.0/include -c debug.c arm-linux-gnueabi-gcc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/arm-linux-gnueabi/glib-2.0/include -c emit.c arm-linux-gnueabi-gcc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/arm-linux-gnueabi/glib-2.0/include -c emulation.c arm-linux-gnueabi-gcc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/arm-linux-gnueabi/glib-2.0/include -c histogram.c arm-linux-gnueabi-gcc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/arm-linux-gnueabi/glib-2.0/include -c hmmio.c arm-linux-gnueabi-gcc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/arm-linux-gnueabi/glib-2.0/include -c mathsupport.c arm-linux-gnueabi-gcc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/arm-linux-gnueabi/glib-2.0/include -c masks.c arm-linux-gnueabi-gcc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/arm-linux-gnueabi/glib-2.0/include -c misc.c arm-linux-gnueabi-gcc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/arm-linux-gnueabi/glib-2.0/include -c modelmakers.c arm-linux-gnueabi-gcc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/arm-linux-gnueabi/glib-2.0/include -c plan7.c arm-linux-gnueabi-gcc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/arm-linux-gnueabi/glib-2.0/include -c plan9.c arm-linux-gnueabi-gcc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/arm-linux-gnueabi/glib-2.0/include -c prior.c prior.c: In function ‘P7ReadPrior’: prior.c:102:12: warning: implicit declaration of function ‘strcmp’ [-Wimplicit-function-declaration] 102 | if (strcmp(sptr, "DIRICHLET") == 0) pri->strategy = PRI_DCHLET; | ^~~~~~ arm-linux-gnueabi-gcc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/arm-linux-gnueabi/glib-2.0/include -c tophits.c arm-linux-gnueabi-gcc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/arm-linux-gnueabi/glib-2.0/include -c trace.c arm-linux-gnueabi-gcc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/arm-linux-gnueabi/glib-2.0/include -c aligneval.c arm-linux-gnueabi-gcc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/arm-linux-gnueabi/glib-2.0/include -c alignio.c arm-linux-gnueabi-gcc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/arm-linux-gnueabi/glib-2.0/include -c cluster.c arm-linux-gnueabi-gcc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/arm-linux-gnueabi/glib-2.0/include -c dayhoff.c arm-linux-gnueabi-gcc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/arm-linux-gnueabi/glib-2.0/include -c file.c arm-linux-gnueabi-gcc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/arm-linux-gnueabi/glib-2.0/include -c getopt.c arm-linux-gnueabi-gcc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/arm-linux-gnueabi/glib-2.0/include -c gnuregex.c arm-linux-gnueabi-gcc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/arm-linux-gnueabi/glib-2.0/include -c interleaved.c arm-linux-gnueabi-gcc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/arm-linux-gnueabi/glib-2.0/include -c iupac.c arm-linux-gnueabi-gcc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/arm-linux-gnueabi/glib-2.0/include -c msf.c arm-linux-gnueabi-gcc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/arm-linux-gnueabi/glib-2.0/include -c revcomp.c arm-linux-gnueabi-gcc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/arm-linux-gnueabi/glib-2.0/include -c selex.c arm-linux-gnueabi-gcc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/arm-linux-gnueabi/glib-2.0/include -c sqerror.c arm-linux-gnueabi-gcc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/arm-linux-gnueabi/glib-2.0/include -c sqio.c arm-linux-gnueabi-gcc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/arm-linux-gnueabi/glib-2.0/include -c sre_ctype.c arm-linux-gnueabi-gcc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/arm-linux-gnueabi/glib-2.0/include -c sre_math.c arm-linux-gnueabi-gcc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/arm-linux-gnueabi/glib-2.0/include -c sre_string.c arm-linux-gnueabi-gcc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/arm-linux-gnueabi/glib-2.0/include -c stack.c arm-linux-gnueabi-gcc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/arm-linux-gnueabi/glib-2.0/include -c translate.c arm-linux-gnueabi-gcc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/arm-linux-gnueabi/glib-2.0/include -c types.c arm-linux-gnueabi-gcc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/arm-linux-gnueabi/glib-2.0/include -c weight.c ar rcv libhmmer.a alphabet.o core_algorithms.o debug.o emit.o emulation.o histogram.o hmmio.o mathsupport.o masks.o misc.o modelmakers.o plan7.o plan9.o prior.o tophits.o trace.o aligneval.o alignio.o cluster.o dayhoff.o file.o getopt.o gnuregex.o interleaved.o iupac.o msf.o revcomp.o selex.o sqerror.o sqio.o sre_ctype.o sre_math.o sre_string.o stack.o translate.o types.o weight.o a - alphabet.o a - core_algorithms.o a - debug.o a - emit.o a - emulation.o a - histogram.o a - hmmio.o a - mathsupport.o a - masks.o a - misc.o a - modelmakers.o a - plan7.o a - plan9.o a - prior.o a - tophits.o a - trace.o a - aligneval.o a - alignio.o a - cluster.o a - dayhoff.o a - file.o a - getopt.o a - gnuregex.o a - interleaved.o a - iupac.o a - msf.o a - revcomp.o a - selex.o a - sqerror.o a - sqio.o a - sre_ctype.o a - sre_math.o a - sre_string.o a - stack.o a - translate.o a - types.o a - weight.o if test -x /bin/ranlib; then /bin/ranlib libhmmer.a; else exit 0; fi if test -x /usr/bin/ranlib; then /usr/bin/ranlib libhmmer.a; else exit 0; fi if test -x ranlib; then ranlib libhmmer.a; else exit 0; fi chmod 644 libhmmer.a make[3]: Leaving directory '/<>/src/HMMer2' (cd dynlibsrc ; make CC="arm-linux-gnueabi-gcc" CFLAGS="-g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c `arm-linux-gnueabi-pkg-config --cflags glib-2.0`" libdyna.a ) make[3]: Entering directory '/<>/src/dynlibsrc' arm-linux-gnueabi-gcc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/arm-linux-gnueabi/glib-2.0/include -I../base/ packaln.c packaln.dy: In function ‘Wise2_read_simple_PackAln’: packaln.dy:88:3: warning: ignoring return value of ‘fgets’ declared with attribute ‘warn_unused_result’ [-Wunused-result] 88 | fgets(buffer,MAXLINE,ifp); | ^~~~~~~~~~~~~~~~~~~~~~~~~ arm-linux-gnueabi-gcc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/arm-linux-gnueabi/glib-2.0/include -I../base/ aln.c aln.dy: In function ‘Wise2_mapped_ascii_AlnBlock’: aln.dy:867:19: warning: too many arguments for format [-Wformat-extra-args] 867 | fprintf(ofp," {%3.2f} ",(double)(*score_to_double)(cuml),cuml); | ^~~~~~~~~~~~ arm-linux-gnueabi-gcc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/arm-linux-gnueabi/glib-2.0/include -I../base/ dnamatrix.c arm-linux-gnueabi-gcc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/arm-linux-gnueabi/glib-2.0/include -I../base/ probability.c arm-linux-gnueabi-gcc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/arm-linux-gnueabi/glib-2.0/include -I../base/ alnrange.c arm-linux-gnueabi-gcc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/arm-linux-gnueabi/glib-2.0/include -I../base/ alnconvert.c arm-linux-gnueabi-gcc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/arm-linux-gnueabi/glib-2.0/include -I../base/ basematrix.c arm-linux-gnueabi-gcc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/arm-linux-gnueabi/glib-2.0/include -I../base/ shattermatrix.c arm-linux-gnueabi-gcc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/arm-linux-gnueabi/glib-2.0/include -I../base/ matrixdebug.c matrixdebug.dy: In function ‘Wise2_user_DebugMatrix’: matrixdebug.dy:208:5: warning: ignoring return value of ‘fgets’ declared with attribute ‘warn_unused_result’ [-Wunused-result] 208 | fgets(buffer,MAXLINE,in); | ^~~~~~~~~~~~~~~~~~~~~~~~ arm-linux-gnueabi-gcc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/arm-linux-gnueabi/glib-2.0/include -I../base/ dpenvelope.c arm-linux-gnueabi-gcc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/arm-linux-gnueabi/glib-2.0/include -I../base/ dbsearchimpl.c arm-linux-gnueabi-gcc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/arm-linux-gnueabi/glib-2.0/include -I../base/ dprunimpl.c arm-linux-gnueabi-gcc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/arm-linux-gnueabi/glib-2.0/include -I../base/ complexsequence.c arm-linux-gnueabi-gcc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/arm-linux-gnueabi/glib-2.0/include -I../base/ complexevalset.c arm-linux-gnueabi-gcc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/arm-linux-gnueabi/glib-2.0/include -I../base/ complexconsensi.c arm-linux-gnueabi-gcc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/arm-linux-gnueabi/glib-2.0/include -I../base/ sequence.c arm-linux-gnueabi-gcc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/arm-linux-gnueabi/glib-2.0/include -I../base/ sequencestream.c arm-linux-gnueabi-gcc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/arm-linux-gnueabi/glib-2.0/include -I../base/ seqalign.c arm-linux-gnueabi-gcc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/arm-linux-gnueabi/glib-2.0/include -I../base/ hitlist.c arm-linux-gnueabi-gcc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/arm-linux-gnueabi/glib-2.0/include -I../base/ hsp.c arm-linux-gnueabi-gcc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/arm-linux-gnueabi/glib-2.0/include -I../base/ hspstream.c arm-linux-gnueabi-gcc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/arm-linux-gnueabi/glib-2.0/include -I../base/ codon.c arm-linux-gnueabi-gcc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/arm-linux-gnueabi/glib-2.0/include -I../base/ compmat.c arm-linux-gnueabi-gcc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/arm-linux-gnueabi/glib-2.0/include -I../base/ codonmatrix.c arm-linux-gnueabi-gcc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/arm-linux-gnueabi/glib-2.0/include -I../base/ codonmapper.c arm-linux-gnueabi-gcc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/arm-linux-gnueabi/glib-2.0/include -I../base/ sequencedb.c arm-linux-gnueabi-gcc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/arm-linux-gnueabi/glib-2.0/include -I../base/ hscore.c arm-linux-gnueabi-gcc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/arm-linux-gnueabi/glib-2.0/include -I../base/ seqlookup.c arm-linux-gnueabi-gcc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/arm-linux-gnueabi/glib-2.0/include -I../base/ arrayseqlookup.c arm-linux-gnueabi-gcc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/arm-linux-gnueabi/glib-2.0/include -I../base/ genericindexresult.c arm-linux-gnueabi-gcc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/arm-linux-gnueabi/glib-2.0/include -I../base/ linkedlist_lookpos.c arm-linux-gnueabi-gcc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/arm-linux-gnueabi/glib-2.0/include -I../base/ singlenumberspace.c arm-linux-gnueabi-gcc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/arm-linux-gnueabi/glib-2.0/include -I../base/ histogram.c arm-linux-gnueabi-gcc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/arm-linux-gnueabi/glib-2.0/include -I../base/ searchstatinterface.c arm-linux-gnueabi-gcc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/arm-linux-gnueabi/glib-2.0/include -I../base/ searchstatlookup.c arm-linux-gnueabi-gcc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/arm-linux-gnueabi/glib-2.0/include -I../base/ proteindb.c arm-linux-gnueabi-gcc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/arm-linux-gnueabi/glib-2.0/include -I../base/ protein.c arm-linux-gnueabi-gcc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/arm-linux-gnueabi/glib-2.0/include -I../base/ pairbase.c arm-linux-gnueabi-gcc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/arm-linux-gnueabi/glib-2.0/include -I../base/ pairbaseseq.c arm-linux-gnueabi-gcc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/arm-linux-gnueabi/glib-2.0/include -I../base/ genomicdb.c arm-linux-gnueabi-gcc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/arm-linux-gnueabi/glib-2.0/include -I../base/ randommodel.c arm-linux-gnueabi-gcc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/arm-linux-gnueabi/glib-2.0/include -I../base/ randomdb.c arm-linux-gnueabi-gcc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/arm-linux-gnueabi/glib-2.0/include -I../base/ genomic.c arm-linux-gnueabi-gcc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/arm-linux-gnueabi/glib-2.0/include -I../base/ cdna.c arm-linux-gnueabi-gcc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/arm-linux-gnueabi/glib-2.0/include -I../base/ cdnadb.c arm-linux-gnueabi-gcc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/arm-linux-gnueabi/glib-2.0/include -I../base/ dna.c arm-linux-gnueabi-gcc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/arm-linux-gnueabi/glib-2.0/include -I../base/ embl.c arm-linux-gnueabi-gcc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/arm-linux-gnueabi/glib-2.0/include -I../base/ genomicregion.c genomicregion.dy: In function ‘Wise2_read_EMBL_FT_into_GenomicRegion’: genomicregion.dy:756:3: warning: ignoring return value of ‘fgets’ declared with attribute ‘warn_unused_result’ [-Wunused-result] 756 | fgets(buffer,maxlen,ifp); | ^~~~~~~~~~~~~~~~~~~~~~~~ arm-linux-gnueabi-gcc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/arm-linux-gnueabi/glib-2.0/include -I../base/ gene.c arm-linux-gnueabi-gcc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/arm-linux-gnueabi/glib-2.0/include -I../base/ transcript.c arm-linux-gnueabi-gcc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/arm-linux-gnueabi/glib-2.0/include -I../base/ translation.c arm-linux-gnueabi-gcc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/arm-linux-gnueabi/glib-2.0/include -I../base/ btcanvas.c arm-linux-gnueabi-gcc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/arm-linux-gnueabi/glib-2.0/include -I../base/ asciibtcanvas.c arm-linux-gnueabi-gcc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/arm-linux-gnueabi/glib-2.0/include -I../base/ dynlibcross.c ar ru libdyna.a packaln.o aln.o dnamatrix.o probability.o alnrange.o alnconvert.o basematrix.o shattermatrix.o matrixdebug.o dpenvelope.o dbsearchimpl.o dprunimpl.o complexsequence.o complexevalset.o complexconsensi.o sequence.o sequencestream.o seqalign.o hitlist.o hsp.o hspstream.o codon.o compmat.o codonmatrix.o codonmapper.o sequencedb.o hscore.o seqlookup.o arrayseqlookup.o genericindexresult.o linkedlist_lookpos.o singlenumberspace.o histogram.o searchstatinterface.o searchstatlookup.o proteindb.o protein.o pairbase.o pairbaseseq.o genomicdb.o randommodel.o randomdb.o genomic.o cdna.o cdnadb.o dna.o embl.o genomicregion.o gene.o transcript.o translation.o btcanvas.o asciibtcanvas.o dynlibcross.o ar: `u' modifier ignored since `D' is the default (see `U') ar: creating libdyna.a if test -x /bin/ranlib; then /bin/ranlib libdyna.a; else exit 0; fi if test -x /usr/bin/ranlib; then /usr/bin/ranlib libdyna.a; else exit 0; fi make[3]: Leaving directory '/<>/src/dynlibsrc' (cd dynlibsrc ; make CC="arm-linux-gnueabi-gcc" CFLAGS="-g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c `arm-linux-gnueabi-pkg-config --cflags glib-2.0`" libdyna_glib.a ) make[3]: Entering directory '/<>/src/dynlibsrc' arm-linux-gnueabi-gcc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/arm-linux-gnueabi/glib-2.0/include -I../base/ subseqhash.c arm-linux-gnueabi-gcc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/arm-linux-gnueabi/glib-2.0/include -I../base/ intallocator.c intallocator.dy: In function ‘Wise2_show_allocator_status_IntAllocator’: intallocator.dy:216:15: warning: format ‘%ld’ expects argument of type ‘long int’, but argument 4 has type ‘unsigned int’ [-Wformat=] 216 | fprintf(ofp,"%d blocks allocated, using %ld bytes\n",ia->current_allocated_block,ia->current_allocated_block * (sizeof(IntAllocatorHeader)+(sizeof(int)*ia->size)) * IntAllocator_BLOCKSIZE); | ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ arm-linux-gnueabi-gcc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/arm-linux-gnueabi/glib-2.0/include -I../base/ proteinstreamedindex.c arm-linux-gnueabi-gcc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/arm-linux-gnueabi/glib-2.0/include -I../base/ shadowseq.c arm-linux-gnueabi-gcc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/arm-linux-gnueabi/glib-2.0/include -I../base/ shadowseqindex.c shadowseqindex.dy: In function ‘Wise2_dump_stats_ShadowSequenceIndex’: shadowseqindex.dy:285:15: warning: format ‘%f’ expects argument of type ‘double’, but argument 4 has type ‘unsigned int’ [-Wformat=] 285 | fprintf(ofp,"Head memory %d [%.2f Mbytes]\n",total_head,(total_head*sizeof(ShadowArraySeqHead))/100000); | ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ | | | unsigned int arm-linux-gnueabi-gcc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/arm-linux-gnueabi/glib-2.0/include -I../base/ hsphandler.c arm-linux-gnueabi-gcc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/arm-linux-gnueabi/glib-2.0/include -I../base/ hspscaninterface.c arm-linux-gnueabi-gcc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/arm-linux-gnueabi/glib-2.0/include -I../base/ hsp2hitscan.c hsp2hitscan.dy: In function ‘Wise2_one_off_two_hit_HSPscan_query_direct’: hsp2hitscan.dy:209:18: warning: format ‘%d’ expects argument of type ‘int’, but argument 3 has type ‘__time_t’ {aka ‘long int’} [-Wformat=] 209 | fprintf(stderr,"START %d.%03du %d.%03ds \n", | ^~~~~~~~~~~~~~~~~~~~~~~~~~~~ 210 | use.ru_utime.tv_sec, | ~~~~~~~~~~~~~~~~~~~ | | | __time_t {aka long int} hsp2hitscan.dy:209:18: warning: format ‘%d’ expects argument of type ‘int’, but argument 4 has type ‘long int’ [-Wformat=] hsp2hitscan.dy:209:18: warning: format ‘%d’ expects argument of type ‘int’, but argument 5 has type ‘__time_t’ {aka ‘long int’} [-Wformat=] hsp2hitscan.dy:209:18: warning: format ‘%d’ expects argument of type ‘int’, but argument 6 has type ‘long int’ [-Wformat=] hsp2hitscan.dy:273:18: warning: format ‘%d’ expects argument of type ‘int’, but argument 3 has type ‘__time_t’ {aka ‘long int’} [-Wformat=] 273 | fprintf(stderr,"END OF SEED %d.%03du %d.%03ds \n", | ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 274 | use.ru_utime.tv_sec, | ~~~~~~~~~~~~~~~~~~~ | | | __time_t {aka long int} hsp2hitscan.dy:273:18: warning: format ‘%d’ expects argument of type ‘int’, but argument 4 has type ‘long int’ [-Wformat=] hsp2hitscan.dy:273:18: warning: format ‘%d’ expects argument of type ‘int’, but argument 5 has type ‘__time_t’ {aka ‘long int’} [-Wformat=] hsp2hitscan.dy:273:18: warning: format ‘%d’ expects argument of type ‘int’, but argument 6 has type ‘long int’ [-Wformat=] hsp2hitscan.dy:286:18: warning: format ‘%d’ expects argument of type ‘int’, but argument 3 has type ‘__time_t’ {aka ‘long int’} [-Wformat=] 286 | fprintf(stderr,"POPULATION %d.%03du %d.%03ds \n", | ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 287 | use.ru_utime.tv_sec, | ~~~~~~~~~~~~~~~~~~~ | | | __time_t {aka long int} hsp2hitscan.dy:286:18: warning: format ‘%d’ expects argument of type ‘int’, but argument 4 has type ‘long int’ [-Wformat=] hsp2hitscan.dy:286:18: warning: format ‘%d’ expects argument of type ‘int’, but argument 5 has type ‘__time_t’ {aka ‘long int’} [-Wformat=] hsp2hitscan.dy:286:18: warning: format ‘%d’ expects argument of type ‘int’, but argument 6 has type ‘long int’ [-Wformat=] hsp2hitscan.dy:302:18: warning: format ‘%d’ expects argument of type ‘int’, but argument 3 has type ‘__time_t’ {aka ‘long int’} [-Wformat=] 302 | fprintf(stdout,"LINEARISED %d.%03du %d.%03ds \n", | ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 303 | use.ru_utime.tv_sec, | ~~~~~~~~~~~~~~~~~~~ | | | __time_t {aka long int} hsp2hitscan.dy:302:18: warning: format ‘%d’ expects argument of type ‘int’, but argument 4 has type ‘long int’ [-Wformat=] hsp2hitscan.dy:302:18: warning: format ‘%d’ expects argument of type ‘int’, but argument 5 has type ‘__time_t’ {aka ‘long int’} [-Wformat=] hsp2hitscan.dy:302:18: warning: format ‘%d’ expects argument of type ‘int’, but argument 6 has type ‘long int’ [-Wformat=] arm-linux-gnueabi-gcc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/arm-linux-gnueabi/glib-2.0/include -I../base/ hsplookupscan.c arm-linux-gnueabi-gcc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/arm-linux-gnueabi/glib-2.0/include -I../base/ hsplookupthreaded.c hsplookupthreaded.dy: In function ‘Wise2_one_off_ordered_HSPscan_scan_query_direct’: hsplookupthreaded.dy:263:18: warning: format ‘%d’ expects argument of type ‘int’, but argument 3 has type ‘long int’ [-Wformat=] 263 | fprintf(stderr,"retrieved array with %d elements\n",current_oph); | ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~ | | | long int arm-linux-gnueabi-gcc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/arm-linux-gnueabi/glib-2.0/include -I../base/ hspthreadeddb.c hspthreadeddb.dy: In function ‘Wise2_threadeddb_scan_worker’: hspthreadeddb.dy:154:18: warning: format ‘%d’ expects argument of type ‘int’, but argument 3 has type ‘Wise2_HSPDatabaseSegment *’ [-Wformat=] 154 | fprintf(stderr,"For segment %d, finished query with %d (%d) linear\n",seg,(int)seg->lm,seg->lm->len); | ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~ | | | Wise2_HSPDatabaseSegment * arm-linux-gnueabi-gcc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/arm-linux-gnueabi/glib-2.0/include -I../base/ hspscanruntime.c arm-linux-gnueabi-gcc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/arm-linux-gnueabi/glib-2.0/include -I../base/ hsptwohitscan.c arm-linux-gnueabi-gcc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/arm-linux-gnueabi/glib-2.0/include -I../base/ proteinindexcons.c arm-linux-gnueabi-gcc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/arm-linux-gnueabi/glib-2.0/include -I../base/ dnaindexcons.c arm-linux-gnueabi-gcc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/arm-linux-gnueabi/glib-2.0/include -I../base/ staticseq.c ar ru libdyna_glib.a subseqhash.o intallocator.o proteinstreamedindex.o shadowseq.o shadowseqindex.o hsphandler.o hspscaninterface.o hsp2hitscan.o hsplookupscan.o hsplookupthreaded.o hspthreadeddb.o hspscanruntime.o hsptwohitscan.o proteinindexcons.o dnaindexcons.o staticseq.o ar: `u' modifier ignored since `D' is the default (see `U') ar: creating libdyna_glib.a if test -x /bin/ranlib; then /bin/ranlib libdyna_glib.a; else exit 0; fi if test -x /usr/bin/ranlib; then /usr/bin/ranlib libdyna_glib.a; else exit 0; fi make[3]: Leaving directory '/<>/src/dynlibsrc' (cd external ; make CC="arm-linux-gnueabi-gcc" CFLAGS="-g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c `arm-linux-gnueabi-pkg-config --cflags glib-2.0`" all ) make[3]: Entering directory '/<>/src/external' (cd mott; make CC="arm-linux-gnueabi-gcc" CFLAGS="-g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/arm-linux-gnueabi/glib-2.0/include" all) make[4]: Entering directory '/<>/src/external/mott' arm-linux-gnueabi-gcc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/arm-linux-gnueabi/glib-2.0/include -Wdate-time -D_FORTIFY_SOURCE=2 -c -o mott_api.o mott_api.c mott_api.c: In function ‘InitPvaluesMott’: mott_api.c:64:3: warning: implicit declaration of function ‘free’ [-Wimplicit-function-declaration] 64 | free(freq0); | ^~~~ mott_api.c:64:3: warning: incompatible implicit declaration of built-in function ‘free’ mott_api.c:5:1: note: include ‘’ or provide a declaration of ‘free’ 4 | #include"gapstat.h" +++ |+#include 5 | mott_api.c: In function ‘SW_PValueMott’: mott_api.c:104:7: warning: incompatible implicit declaration of built-in function ‘free’ 104 | free(freqA); | ^~~~ mott_api.c:104:7: note: include ‘’ or provide a declaration of ‘free’ mott_api.c: In function ‘KarlinAltschulStatistics2’: mott_api.c:144:5: warning: incompatible implicit declaration of built-in function ‘free’ 144 | free(h+hmin); | ^~~~ mott_api.c:144:5: note: include ‘’ or provide a declaration of ‘free’ mott_api.c:155:5: warning: incompatible implicit declaration of built-in function ‘free’ 155 | free(h+hmin); | ^~~~ mott_api.c:155:5: note: include ‘’ or provide a declaration of ‘free’ mott_api.c: In function ‘GetHistogram’: mott_api.c:179:16: warning: implicit declaration of function ‘calloc’ [-Wimplicit-function-declaration] 179 | h = (double*)calloc(*hmax-*hmin+1,sizeof(double))-*hmin; | ^~~~~~ mott_api.c:179:16: warning: incompatible implicit declaration of built-in function ‘calloc’ mott_api.c:179:16: note: include ‘’ or provide a declaration of ‘calloc’ mott_api.c: In function ‘PseudoResidueFrequencies2’: mott_api.c:207:12: warning: implicit declaration of function ‘toupper’ [-Wimplicit-function-declaration] 207 | freq[toupper(seq[n])]++; | ^~~~~~~ mott_api.c: In function ‘RobinsonResidueFrequencies2’: mott_api.c:230:27: warning: incompatible implicit declaration of built-in function ‘calloc’ 230 | double *freq = (double*)calloc(256, sizeof(double)); | ^~~~~~ mott_api.c:230:27: note: include ‘’ or provide a declaration of ‘calloc’ arm-linux-gnueabi-gcc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/arm-linux-gnueabi/glib-2.0/include -Wdate-time -D_FORTIFY_SOURCE=2 -c -o gaplib.o gaplib.c arm-linux-gnueabi-gcc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/arm-linux-gnueabi/glib-2.0/include -I../../dynlibsrc -I../../base wise2_mott_bridge.c ar ru libmott.a mott_api.o gaplib.o wise2_mott_bridge.o ar: `u' modifier ignored since `D' is the default (see `U') ar: creating libmott.a if test -x /bin/ranlib; then /bin/ranlib libmott.a; else exit 0; fi if test -x /usr/bin/ranlib; then /usr/bin/ranlib libmott.a; else exit 0; fi make[4]: Leaving directory '/<>/src/external/mott' make[3]: Leaving directory '/<>/src/external' (cd socket ; make CC="arm-linux-gnueabi-gcc" CFLAGS="-g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c `arm-linux-gnueabi-pkg-config --cflags glib-2.0`" libwisesocket.a ) make[3]: Entering directory '/<>/src/socket' arm-linux-gnueabi-gcc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/arm-linux-gnueabi/glib-2.0/include -I../base/ functionserver.c functionserver.dy: In function ‘Wise2_main_loop_forking_FunctionServer’: functionserver.dy:129:4: warning: ignoring return value of ‘write’ declared with attribute ‘warn_unused_result’ [-Wunused-result] 129 | write(new_socket,buf,9); | ^~~~~~~~~~~~~~~~~~~~~~~ functionserver.dy:141:2: warning: ignoring return value of ‘write’ declared with attribute ‘warn_unused_result’ [-Wunused-result] 141 | write(new_socket,buf,6); | ^~~~~~~~~~~~~~~~~~~~~~~ functionserver.dy:183:2: warning: ignoring return value of ‘write’ declared with attribute ‘warn_unused_result’ [-Wunused-result] 183 | write(new_socket,buf,5); | ^~~~~~~~~~~~~~~~~~~~~~~ arm-linux-gnueabi-gcc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/arm-linux-gnueabi/glib-2.0/include -I../base/ functionclient.c functionclient.dy: In function ‘Wise2_new_FunctionProxyCoordinator’: functionclient.dy:193:24: warning: passing argument 2 of ‘connect’ from incompatible pointer type [-Wincompatible-pointer-types] 193 | connect(out->socket, &server, sizeof(server)); | ^~~~~~~ | | | struct sockaddr_in * In file included from functionclient.c:7: /usr/arm-linux-gnueabi/include/sys/socket.h:126:52: note: expected ‘const struct sockaddr *’ but argument is of type ‘struct sockaddr_in *’ 126 | extern int connect (int __fd, __CONST_SOCKADDR_ARG __addr, socklen_t __len); | ^ arm-linux-gnueabi-gcc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/arm-linux-gnueabi/glib-2.0/include -I../base/ anonobj.c arm-linux-gnueabi-gcc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/arm-linux-gnueabi/glib-2.0/include -I../base/ transferinterface.c arm-linux-gnueabi-gcc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/arm-linux-gnueabi/glib-2.0/include -I../base/ directsocketwrite.c ar ru libwisesocket.a functionserver.o functionclient.o anonobj.o transferinterface.o directsocketwrite.o ar: `u' modifier ignored since `D' is the default (see `U') ar: creating libwisesocket.a if test -x /bin/ranlib; then /bin/ranlib libwisesocket.a; else exit 0; fi if test -x /usr/bin/ranlib; then /usr/bin/ranlib libwisesocket.a; else exit 0; fi make[3]: Leaving directory '/<>/src/socket' (cd dnaindex ; make CC="arm-linux-gnueabi-gcc" CFLAGS="-g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c `arm-linux-gnueabi-pkg-config --cflags glib-2.0`" all ) make[3]: Entering directory '/<>/src/dnaindex' arm-linux-gnueabi-gcc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/arm-linux-gnueabi/glib-2.0/include -I../base/ -I../dynlibsrc/ -I../models kmer_assembly.c kmer_assembly.dy: In function ‘Wise2_show_KmerAssemblyNode’: kmer_assembly.dy:296:15: warning: format ‘%ld’ expects argument of type ‘long int’, but argument 3 has type ‘kmer_t’ {aka ‘long long int’} [-Wformat=] 296 | fprintf(ofp,"Node %ld of sequence %s \n",node->number,buffer); | ^~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~ | | | kmer_t {aka long long int} kmer_assembly.dy:302:17: warning: format ‘%ld’ expects argument of type ‘long int’, but argument 5 has type ‘kmer_t’ {aka ‘long long int’} [-Wformat=] 302 | fprintf(ofp," ... prev ... %c, %d to %ld\n",node->prev[i]->base,node->prev[i]->sequence_label_len,node->prev[i]->prev->number); | ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~ | | | kmer_t {aka long long int} kmer_assembly.dy:309:17: warning: format ‘%ld’ expects argument of type ‘long int’, but argument 5 has type ‘kmer_t’ {aka ‘long long int’} [-Wformat=] 309 | fprintf(ofp," ... next ... %c, %d to %ld\n",node->next[i]->base,node->next[i]->sequence_label_len,node->next[i]->next->number); | ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~ | | | kmer_t {aka long long int} kmer_assembly.dy: In function ‘Wise2_remove_sequence_label_KmerAssemblyLink’: kmer_assembly.dy:365:18: warning: format ‘%ld’ expects argument of type ‘long int’, but argument 4 has type ‘KmerAssemblyLink *’ [-Wformat=] 365 | fprintf(stderr," ...unable to remove label %ld from link %ld (%d labels)\n",label,kal,kal->sequence_label_len); | ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~ | | | KmerAssemblyLink * kmer_assembly.dy:367:20: warning: format ‘%d’ expects a matching ‘int’ argument [-Wformat=] 367 | fprintf(stderr," [%ld] is %d label\n",kal->sequence_label[i]); | ^~~~~~~~~~~~~~~~~~~~~~~~~~ arm-linux-gnueabi-gcc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/arm-linux-gnueabi/glib-2.0/include -I../base/ -I../dynlibsrc/ -I../models kmer_index_interface.c arm-linux-gnueabi-gcc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/arm-linux-gnueabi/glib-2.0/include -I../base/ -I../dynlibsrc/ -I../models kmer_direct.c arm-linux-gnueabi-gcc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/arm-linux-gnueabi/glib-2.0/include -I../base/ -I../dynlibsrc/ -I../models kmer_hash.c kmer_hash.dy: In function ‘Wise2_free_KmerHashIndex’: kmer_hash.dy:318:19: warning: format ‘%lx’ expects argument of type ‘long unsigned int’, but argument 3 has type ‘kmer_t’ {aka ‘long long int’} [-Wformat=] 318 | fprintf(stderr, "min_kmer: %016lx\n", khi->min_kmer); | ^~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~ | | | kmer_t {aka long long int} kmer_hash.dy:319:19: warning: format ‘%lx’ expects argument of type ‘long unsigned int’, but argument 3 has type ‘kmer_t’ {aka ‘long long int’} [-Wformat=] 319 | fprintf(stderr, "max_kmer: %016lx\n", khi->max_kmer); | ^~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~ | | | kmer_t {aka long long int} arm-linux-gnueabi-gcc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/arm-linux-gnueabi/glib-2.0/include -I../base/ -I../dynlibsrc/ -I../models kmer_count.c arm-linux-gnueabi-gcc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/arm-linux-gnueabi/glib-2.0/include -I../base/ -I../dynlibsrc/ -I../models kmer_glib_index.c kmer_glib_index.dy: In function ‘Wise2_retrieve_by_kmer_KmerGlibIndex’: kmer_glib_index.dy:77:48: warning: cast to pointer from integer of different size [-Wint-to-pointer-cast] 77 | return (void*) g_hash_table_lookup(kgi->hash,(gconstpointer)kmer); | ^ kmer_glib_index.dy: In function ‘Wise2_insert_by_kmer_KmerGlibIndex’: kmer_glib_index.dy:84:33: warning: cast to pointer from integer of different size [-Wint-to-pointer-cast] 84 | g_hash_table_insert(kgi->hash,(gpointer)kmer,poi); | ^ kmer_glib_index.dy: In function ‘Wise2_retrieve_active_kmer_KmerGlibIndex’: kmer_glib_index.dy:124:40: warning: cast from pointer to integer of different size [-Wpointer-to-int-cast] 124 | kgi->active_index[kgi->kmer_pos++] = (kmer_t) key; | ^ arm-linux-gnueabi-gcc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/arm-linux-gnueabi/glib-2.0/include -I../base/ -I../dynlibsrc/ -I../models singleseqspace.c arm-linux-gnueabi-gcc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/arm-linux-gnueabi/glib-2.0/include -I../base/ -I../dynlibsrc/ -I../models dnamapping.c arm-linux-gnueabi-gcc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/arm-linux-gnueabi/glib-2.0/include -I../base/ -I../dynlibsrc/ -I../models largeseqreader.c arm-linux-gnueabi-gcc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/arm-linux-gnueabi/glib-2.0/include -I../base/ -I../dynlibsrc/ -I../models kmer_assembly_untangler.c kmer_assembly_untangler.dy: In function ‘Wise2_untangle_KmerAssembly’: kmer_assembly_untangler.dy:120:22: warning: format ‘%ld’ expects argument of type ‘long int’, but argument 3 has type ‘kmer_t’ {aka ‘long long int’} [-Wformat=] 120 | fprintf(stderr,"TANGLE: Node %ld, %s has forward %d and back %d links\n",node->number,buffer,node->next_len,node->prev_len); | ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~ | | | kmer_t {aka long long int} kmer_assembly_untangler.dy:141:22: warning: format ‘%ld’ expects argument of type ‘long int’, but argument 3 has type ‘kmer_t’ {aka ‘long long int’} [-Wformat=] 141 | fprintf(stderr,"Will attempt untangle starting at %ld to %ld\n",node->prev[i]->prev->number,node->number); | ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~ | | | kmer_t {aka long long int} kmer_assembly_untangler.dy:141:22: warning: format ‘%ld’ expects argument of type ‘long int’, but argument 4 has type ‘kmer_t’ {aka ‘long long int’} [-Wformat=] kmer_assembly_untangler.dy:157:22: warning: format ‘%ld’ expects argument of type ‘long int’, but argument 3 has type ‘kmer_t’ {aka ‘long long int’} [-Wformat=] 157 | fprintf(stderr,"RESOLVED: Node %ld [%s] Fully untangled now...\n",node->number,buffer); | ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~ | | | kmer_t {aka long long int} kmer_assembly_untangler.dy:159:22: warning: format ‘%ld’ expects argument of type ‘long int’, but argument 3 has type ‘kmer_t’ {aka ‘long long int’} [-Wformat=] 159 | fprintf(stderr,"UNRESOLVED: Node %ld [%s] still tangled...\n",node->number,buffer); | ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~ | | | kmer_t {aka long long int} kmer_assembly_untangler.dy: In function ‘Wise2_old_attempt_forward_untangle_KmerAssembly’: kmer_assembly_untangler.dy:444:20: warning: format ‘%ld’ expects argument of type ‘long int’, but argument 3 has type ‘kmer_t’ {aka ‘long long int’} [-Wformat=] 444 | fprintf(stderr,"looking at node %ld with path length %d, next length %d depth %d\n",current->next->number,pathlen,current->next->next_len,current->sequence_label_len); | ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~ | | | kmer_t {aka long long int} kmer_assembly_untangler.dy:568:75: warning: passing argument 4 of ‘Wise2_lift_backward_tangled_tail’ from incompatible pointer type [-Wincompatible-pointer-types] 568 | lift_backward_tangled_tail(kai,newpath->stack[newpath->stack_len-1],path,transferred_label,transferred_pos,transferred_len); | ^~~~~~~~~~~~~~~~~ | | | long int * In file included from kmer_assembly_untangler.c:4: kmer_assembly_untangler.h:174:116: note: expected ‘int *’ but argument is of type ‘long int *’ 174 | void Wise2_lift_backward_tangled_tail(KmerAssemblyIndex * kai,KmerAssemblyLink * new,KmerAssemblyPath * tail,int * start_label,SinglePosSequence ** positions,int label_len); | ~~~~~~^~~~~~~~~~~ kmer_assembly_untangler.dy: In function ‘Wise2_lift_forward_tangled_KmerAssemblyPath’: kmer_assembly_untangler.dy:746:20: warning: format ‘%ld’ expects argument of type ‘long int’, but argument 6 has type ‘kmer_t’ {aka ‘long long int’} [-Wformat=] 746 | fprintf(stderr,"Moving stack position %d, depth %d, transfer %d, between %ld [%s] and %ld [%s]\n",i,kap->stack[i]->sequence_label_len,label_len,kap->stack[i]->prev->number,back,kap->stack[i]->next->number,forw); | ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~ | | | kmer_t {aka long long int} kmer_assembly_untangler.dy:746:20: warning: format ‘%ld’ expects argument of type ‘long int’, but argument 8 has type ‘kmer_t’ {aka ‘long long int’} [-Wformat=] arm-linux-gnueabi-gcc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/arm-linux-gnueabi/glib-2.0/include -I../base/ -I../dynlibsrc/ -I../models kmer_assembly_contig.c arm-linux-gnueabi-gcc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/arm-linux-gnueabi/glib-2.0/include -I../base/ -I../dynlibsrc/ -I../models kmer_assembly_error.c kmer_assembly_error.dy: In function ‘Wise2_mark_tangles_KmerAssembly’: kmer_assembly_error.dy:93:22: warning: format ‘%ld’ expects argument of type ‘long int’, but argument 3 has type ‘kmer_t’ {aka ‘long long int’} [-Wformat=] 93 | fprintf(stderr,"Marking node (%ld) [%s] as next tangled\n",node->number,buffer); | ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~ | | | kmer_t {aka long long int} kmer_assembly_error.dy:105:22: warning: format ‘%ld’ expects argument of type ‘long int’, but argument 3 has type ‘kmer_t’ {aka ‘long long int’} [-Wformat=] 105 | fprintf(stderr,"Marking node (%ld) [%s] as prev tangled\n",node->number,buffer); | ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~ | | | kmer_t {aka long long int} kmer_assembly_error.dy: In function ‘Wise2_extend_indel_path_KmerAssembly’: kmer_assembly_error.dy:351:17: warning: format ‘%d’ expects argument of type ‘int’, but argument 4 has type ‘int *’ [-Wformat=] 351 | fprintf(stderr,"in considering indel (%d, path %d), real (%c) and error (%c) do not agree at position %d,%d\n",delete_length,current_path,real->base,error->base,real_pos,error_pos); | ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~ | | | int * arm-linux-gnueabi-gcc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/arm-linux-gnueabi/glib-2.0/include -I../base/ -I../dynlibsrc/ -I../models assembly.c arm-linux-gnueabi-gcc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/arm-linux-gnueabi/glib-2.0/include -I../base/ -I../dynlibsrc/ -I../models assembly_stream_interface.c arm-linux-gnueabi-gcc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/arm-linux-gnueabi/glib-2.0/include -I../base/ -I../dynlibsrc/ -I../models assembly_stream_fasta.c arm-linux-gnueabi-gcc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/arm-linux-gnueabi/glib-2.0/include -I../base/ -I../dynlibsrc/ -I../models assembly_sanger_project.c arm-linux-gnueabi-gcc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/arm-linux-gnueabi/glib-2.0/include -I../base/ -I../dynlibsrc/ -I../models assembly_stream_cons.c arm-linux-gnueabi-gcc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/arm-linux-gnueabi/glib-2.0/include -I../base/ -I../dynlibsrc/ -I../models compressed_protein_index.c compressed_protein_index.dy: In function ‘Wise2_add_direct_number_CompressedProteinIndex’: compressed_protein_index.dy:223:10: warning: returning ‘void *’ from a function with return type ‘boolean’ {aka ‘int’} makes integer from pointer without a cast [-Wint-conversion] 223 | return NULL; | ^~~~ make[3]: Leaving directory '/<>/src/dnaindex' (cd network ; make CC="arm-linux-gnueabi-gcc" CFLAGS="-g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c `arm-linux-gnueabi-pkg-config --cflags glib-2.0`" all ) make[3]: Entering directory '/<>/src/network' arm-linux-gnueabi-gcc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/arm-linux-gnueabi/glib-2.0/include -I../base/ -I../socket -I../dynlibsrc -I../dnaindex wise_proteinindex_server.c wise_proteinindex_server.c: In function ‘show_version’: wise_proteinindex_server.c:28:103: warning: macro "__DATE__" might prevent reproducible builds [-Wdate-time] 28 | fprintf(ofp,"%s\nVersion: %s\nReleased: %s\nCompiled: %s\n",program_name,VERSION_NUMBER,RELEASE_DAY,COMPILE_DATE); | ^~~~~~~~~~~~ arm-linux-gnueabi-gcc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/arm-linux-gnueabi/glib-2.0/include -I../base/ -I../socket -I../dynlibsrc -I../dnaindex net_hspscan.c arm-linux-gnueabi-gcc -g -o scanwise_server wise_proteinindex_server.o net_hspscan.o ../dnaindex/compressed_protein_index.o ../dnaindex/kmer_index_interface.o ../dnaindex/singleseqspace.o ../dnaindex/kmer_direct.o -ldyna_glib -ldyna -lwisesocket -lwisebase -Wl,-z,relro -Wl,-z,now -g -L../base/ -L../socket -L../dynlibsrc -L../dnaindex -lm `arm-linux-gnueabi-pkg-config --libs glib-2.0` -lpthread arm-linux-gnueabi-gcc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/arm-linux-gnueabi/glib-2.0/include -I../base/ -I../socket -I../dynlibsrc -I../dnaindex client_multihspscan.c make[3]: Leaving directory '/<>/src/network' (cd models ; make CC="arm-linux-gnueabi-gcc" CFLAGS="-g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c `arm-linux-gnueabi-pkg-config --cflags glib-2.0`" EXTRALIBS="-lm" HMMER_DEFINE="HMMER_INTERNAL" HMMER_INCLUDE="../HMMer2/" HMMER_LIBS="../HMMer2/" all ) make[3]: Entering directory '/<>/src/models' arm-linux-gnueabi-gcc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/arm-linux-gnueabi/glib-2.0/include -I../base/ -I../dynlibsrc/ dnal.c dnal.c: In function ‘show_version’: dnal.c:106:103: warning: macro "__DATE__" might prevent reproducible builds [-Wdate-time] 106 | fprintf(ofp,"%s\nVersion: %s\nReleased: %s\nCompiled: %s\n",program_name,VERSION_NUMBER,RELEASE_DAY,COMPILE_DATE); | ^~~~~~~~~~~~ arm-linux-gnueabi-gcc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/arm-linux-gnueabi/glib-2.0/include -I../base/ -I../dynlibsrc/ dnaalign.c arm-linux-gnueabi-gcc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/arm-linux-gnueabi/glib-2.0/include -I../base/ -I../dynlibsrc/ seqaligndisplay.c arm-linux-gnueabi-gcc -o dnal dnal.o dnaalign.o seqaligndisplay.o -Wl,-z,relro -Wl,-z,now -L../base/ -L../dynlibsrc/ -L../HMMer2/ -lpthread `arm-linux-gnueabi-pkg-config --libs glib-2.0` -ldyna_glib -ldyna -lwisebase -lm arm-linux-gnueabi-gcc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/arm-linux-gnueabi/glib-2.0/include -I../base/ -I../dynlibsrc/ psw.c psw.c: In function ‘show_version’: psw.c:261:103: warning: macro "__DATE__" might prevent reproducible builds [-Wdate-time] 261 | fprintf(ofp,"%s\nVersion: %s\nReleased: %s\nCompiled: %s\n",program_name,VERSION_NUMBER,RELEASE_DAY,COMPILE_DATE); | ^~~~~~~~~~~~ arm-linux-gnueabi-gcc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/arm-linux-gnueabi/glib-2.0/include -I../base/ -I../dynlibsrc/ proteinsw.c arm-linux-gnueabi-gcc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/arm-linux-gnueabi/glib-2.0/include -I../base/ -I../dynlibsrc/ sw_wrap.c arm-linux-gnueabi-gcc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/arm-linux-gnueabi/glib-2.0/include -I../base/ -I../dynlibsrc/ abc.c arm-linux-gnueabi-gcc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/arm-linux-gnueabi/glib-2.0/include -I../base/ -I../dynlibsrc/ pba.c arm-linux-gnueabi-gcc -o psw psw.o sw_wrap.o seqaligndisplay.o proteinsw.o abc.o pba.o -Wl,-z,relro -Wl,-z,now -L../base/ -L../dynlibsrc/ -L../HMMer2/ -lpthread `arm-linux-gnueabi-pkg-config --libs glib-2.0` -ldyna_glib -ldyna -lwisebase -lm arm-linux-gnueabi-gcc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/arm-linux-gnueabi/glib-2.0/include -I../base/ -I../dynlibsrc/ pswdb.c pswdb.c: In function ‘show_version’: pswdb.c:97:106: warning: macro "__DATE__" might prevent reproducible builds [-Wdate-time] 97 | fprintf(stdout,"%s\nVersion: %s\nReleased: %s\nCompiled: %s\n",program_name,VERSION_NUMBER,RELEASE_DAY,COMPILE_DATE); | ^~~~~~~~~~~~ arm-linux-gnueabi-gcc -o pswdb pswdb.o sw_wrap.o seqaligndisplay.o proteinsw.o abc.o pba.o -Wl,-z,relro -Wl,-z,now -L../base/ -L../dynlibsrc/ -L../HMMer2/ -lpthread `arm-linux-gnueabi-pkg-config --libs glib-2.0` -ldyna_glib -ldyna -lwisebase -lm arm-linux-gnueabi-gcc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/arm-linux-gnueabi/glib-2.0/include -I../base/ -I../dynlibsrc/ dbac.c dbac.c: In function ‘show_version’: dbac.c:364:33: warning: macro "__DATE__" might prevent reproducible builds [-Wdate-time] 364 | fprintf(ofp," Compiled %s\n",COMPILE_DATE); | ^~~~~~~~~~~~ arm-linux-gnueabi-gcc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/arm-linux-gnueabi/glib-2.0/include -I../base/ -I../dynlibsrc/ dba.c arm-linux-gnueabi-gcc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/arm-linux-gnueabi/glib-2.0/include -I../base/ -I../dynlibsrc/ slimdba.c arm-linux-gnueabi-gcc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/arm-linux-gnueabi/glib-2.0/include -I../base/ -I../dynlibsrc/ bigdba.c arm-linux-gnueabi-gcc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/arm-linux-gnueabi/glib-2.0/include -I../base/ -I../dynlibsrc/ dbadisplay.c arm-linux-gnueabi-gcc -o dba dbac.o dba.o slimdba.o bigdba.o dbadisplay.o -Wl,-z,relro -Wl,-z,now -L../base/ -L../dynlibsrc/ -L../HMMer2/ -lpthread `arm-linux-gnueabi-pkg-config --libs glib-2.0` -ldyna_glib -ldyna -lwisebase -lm arm-linux-gnueabi-gcc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/arm-linux-gnueabi/glib-2.0/include estwise.c -I../base/ -I../dynlibsrc/ -I../HMMer2/ -I. estwise.c: In function ‘show_version’: estwise.c:559:103: warning: macro "__DATE__" might prevent reproducible builds [-Wdate-time] 559 | fprintf(ofp,"%s\nVersion: %s\nReleased: %s\nCompiled: %s\n",program_name,VERSION_NUMBER,RELEASE_DAY,COMPILE_DATE); | ^~~~~~~~~~~~ arm-linux-gnueabi-gcc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/arm-linux-gnueabi/glib-2.0/include -I../base/ -I../dynlibsrc/ geneparser21.c arm-linux-gnueabi-gcc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/arm-linux-gnueabi/glib-2.0/include -I../base/ -I../dynlibsrc/ geneparameter.c arm-linux-gnueabi-gcc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/arm-linux-gnueabi/glib-2.0/include -I../base/ -I../dynlibsrc/ genestats.c arm-linux-gnueabi-gcc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/arm-linux-gnueabi/glib-2.0/include -I../base/ -I../dynlibsrc/ genewisehsp.c arm-linux-gnueabi-gcc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/arm-linux-gnueabi/glib-2.0/include -I../base/ -I../dynlibsrc/ geneutil.c arm-linux-gnueabi-gcc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/arm-linux-gnueabi/glib-2.0/include -I../base/ -I../dynlibsrc/ geneoutput.c arm-linux-gnueabi-gcc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/arm-linux-gnueabi/glib-2.0/include -I../base/ -I../dynlibsrc/ threestatemodel.c arm-linux-gnueabi-gcc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/arm-linux-gnueabi/glib-2.0/include -I../base/ -I../dynlibsrc/ genefrequency.c arm-linux-gnueabi-gcc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/arm-linux-gnueabi/glib-2.0/include -I../base/ -I../dynlibsrc/ splicesitemodeler.c arm-linux-gnueabi-gcc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/arm-linux-gnueabi/glib-2.0/include -I../base/ -I../dynlibsrc/ genewise4.c arm-linux-gnueabi-gcc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/arm-linux-gnueabi/glib-2.0/include -I../base/ -I../dynlibsrc/ genewise6.c arm-linux-gnueabi-gcc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/arm-linux-gnueabi/glib-2.0/include -I../base/ -I../dynlibsrc/ genestretch6.c arm-linux-gnueabi-gcc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/arm-linux-gnueabi/glib-2.0/include -I../base/ -I../dynlibsrc/ genewise21.c arm-linux-gnueabi-gcc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/arm-linux-gnueabi/glib-2.0/include -I../base/ -I../dynlibsrc/ geneloop21.c arm-linux-gnueabi-gcc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/arm-linux-gnueabi/glib-2.0/include -I../base/ -I../dynlibsrc/ geneloop6.c arm-linux-gnueabi-gcc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/arm-linux-gnueabi/glib-2.0/include -I../base/ -I../dynlibsrc/ genephase6.c arm-linux-gnueabi-gcc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/arm-linux-gnueabi/glib-2.0/include -I../base/ -I../dynlibsrc/ gwlite.c arm-linux-gnueabi-gcc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/arm-linux-gnueabi/glib-2.0/include -I../base/ -I../dynlibsrc/ gwlitemodel.c arm-linux-gnueabi-gcc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/arm-linux-gnueabi/glib-2.0/include -I../base/ -I../dynlibsrc/ gwrap.c arm-linux-gnueabi-gcc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/arm-linux-gnueabi/glib-2.0/include -I../base/ -I../dynlibsrc/ matchsum.c arm-linux-gnueabi-gcc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/arm-linux-gnueabi/glib-2.0/include -I../base/ -I../dynlibsrc/ estwrap.c arm-linux-gnueabi-gcc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/arm-linux-gnueabi/glib-2.0/include -I../base/ -I../dynlibsrc/ genewisemodel.c arm-linux-gnueabi-gcc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/arm-linux-gnueabi/glib-2.0/include -I../base/ -I../dynlibsrc/ phasemodel.c phasemodel.dy: In function ‘Wise2_read_fasta_PhasedProtein’: phasemodel.dy:241:3: warning: ignoring return value of ‘fgets’ declared with attribute ‘warn_unused_result’ [-Wunused-result] 241 | fgets(name,10000,ifp); | ^~~~~~~~~~~~~~~~~~~~~ In file included from /usr/arm-linux-gnueabi/include/stdio.h:867, from ../base/wisebase.h:6, from ../dynlibsrc/probability.h:7, from geneparser21.h:6, from genewisemodel.h:6, from phasemodel.h:6, from phasemodel.c:4: In function ‘fgets’, inlined from ‘Wise2_read_fasta_PhasedProtein’ at phasemodel.dy:241:3: /usr/arm-linux-gnueabi/include/bits/stdio2.h:263:9: warning: call to ‘__fgets_chk_warn’ declared with attribute warning: fgets called with bigger size than length of destination buffer [-Wattribute-warning] 263 | return __fgets_chk_warn (__s, __bos (__s), __n, __stream); | ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ arm-linux-gnueabi-gcc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/arm-linux-gnueabi/glib-2.0/include -I../base/ -I../dynlibsrc/ cdparser.c arm-linux-gnueabi-gcc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/arm-linux-gnueabi/glib-2.0/include -I../base/ -I../dynlibsrc/ genedisplay.c genedisplay.dy: In function ‘Wise2_write_intron_desc’: genedisplay.dy:493:20: warning: too many arguments for format [-Wformat-extra-args] 493 | sprintf(buffer," Intron ??? ",in_number); | ^~~~~~~~~~~~~~~~ arm-linux-gnueabi-gcc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/arm-linux-gnueabi/glib-2.0/include -I../base/ -I../dynlibsrc/ estwise3.c arm-linux-gnueabi-gcc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/arm-linux-gnueabi/glib-2.0/include -I../base/ -I../dynlibsrc/ estslim3.c arm-linux-gnueabi-gcc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/arm-linux-gnueabi/glib-2.0/include -I../base/ -I../dynlibsrc/ estloop3.c arm-linux-gnueabi-gcc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/arm-linux-gnueabi/glib-2.0/include -I../base/ -I../dynlibsrc/ estfrag3.c arm-linux-gnueabi-gcc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/arm-linux-gnueabi/glib-2.0/include -I../base/ -I../dynlibsrc/ estslimloop.c arm-linux-gnueabi-gcc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/arm-linux-gnueabi/glib-2.0/include -I../base/ -I../dynlibsrc/ gwquickdb.c arm-linux-gnueabi-gcc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/arm-linux-gnueabi/glib-2.0/include -I../base/ -I../dynlibsrc/ threestatedb.c arm-linux-gnueabi-gcc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/arm-linux-gnueabi/glib-2.0/include -I../base/ -I../dynlibsrc/ pfamhmmer1db.c arm-linux-gnueabi-gcc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/arm-linux-gnueabi/glib-2.0/include -I../base/ -I../dynlibsrc/ pwmdna.c arm-linux-gnueabi-gcc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/arm-linux-gnueabi/glib-2.0/include -I../HMMer2/ -DHMMER_INTERNAL -I../base/ -I../dynlibsrc/ wise2xhmmer2.c arm-linux-gnueabi-gcc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/arm-linux-gnueabi/glib-2.0/include -I../base/ -I../dynlibsrc/ genewisemodeldb.c arm-linux-gnueabi-gcc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/arm-linux-gnueabi/glib-2.0/include -I../base/ -I../dynlibsrc/ seqhit.c arm-linux-gnueabi-gcc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/arm-linux-gnueabi/glib-2.0/include -I../base/ -I../dynlibsrc/ standardout.c arm-linux-gnueabi-gcc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/arm-linux-gnueabi/glib-2.0/include -I../base/ -I../dynlibsrc/ geneparser4.c arm-linux-gnueabi-gcc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/arm-linux-gnueabi/glib-2.0/include -I../base/ -I../dynlibsrc/ estquick3.c arm-linux-gnueabi-gcc -g -o estwise estwise.o geneparser21.o geneparameter.o genestats.o genewisehsp.o geneutil.o geneoutput.o threestatemodel.o genefrequency.o splicesitemodeler.o genewise4.o genewise6.o genestretch6.o genewise21.o geneloop21.o geneloop6.o genephase6.o gwlite.o gwlitemodel.o gwrap.o matchsum.o estwrap.o genewisemodel.o phasemodel.o cdparser.o genedisplay.o estwise3.o estslim3.o estloop3.o estfrag3.o estslimloop.o gwquickdb.o threestatedb.o pfamhmmer1db.o pwmdna.o wise2xhmmer2.o genewisemodeldb.o seqhit.o standardout.o geneparser4.o sw_wrap.o abc.o pba.o seqaligndisplay.o dbadisplay.o proteinsw.o estquick3.o -Wl,-z,relro -Wl,-z,now -L../base/ -L../dynlibsrc/ -L../HMMer2/ -lpthread `arm-linux-gnueabi-pkg-config --libs glib-2.0` -lhmmer -ldyna_glib -ldyna -lwisebase -lm -Wl,-z,relro -Wl,-z,now -L../base/ -L../dynlibsrc/ -L../HMMer2/ -lpthread `arm-linux-gnueabi-pkg-config --libs glib-2.0` arm-linux-gnueabi-gcc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/arm-linux-gnueabi/glib-2.0/include genewise.c -I../base/ -I../dynlibsrc/ -I../HMMer2/ -I. genewise.c: In function ‘show_version’: genewise.c:860:103: warning: macro "__DATE__" might prevent reproducible builds [-Wdate-time] 860 | fprintf(ofp,"%s\nVersion: %s\nReleased: %s\nCompiled: %s\n",program_name,VERSION_NUMBER,RELEASE_DAY,COMPILE_DATE); | ^~~~~~~~~~~~ arm-linux-gnueabi-gcc -o genewise genewise.o geneparser21.o geneparameter.o genestats.o genewisehsp.o geneutil.o geneoutput.o threestatemodel.o genefrequency.o splicesitemodeler.o genewise4.o genewise6.o genestretch6.o genewise21.o geneloop21.o geneloop6.o genephase6.o gwlite.o gwlitemodel.o gwrap.o matchsum.o estwrap.o genewisemodel.o phasemodel.o cdparser.o genedisplay.o estwise3.o estslim3.o estloop3.o estfrag3.o estslimloop.o gwquickdb.o threestatedb.o pfamhmmer1db.o pwmdna.o wise2xhmmer2.o genewisemodeldb.o seqhit.o standardout.o geneparser4.o sw_wrap.o abc.o pba.o seqaligndisplay.o dbadisplay.o proteinsw.o estquick3.o -Wl,-z,relro -Wl,-z,now -L../base/ -L../dynlibsrc/ -L../HMMer2/ -lpthread `arm-linux-gnueabi-pkg-config --libs glib-2.0` -lhmmer -ldyna_glib -ldyna_glib -ldyna_glib -ldyna -lwisebase -lm -Wl,-z,relro -Wl,-z,now -L../base/ -L../dynlibsrc/ -L../HMMer2/ -lpthread `arm-linux-gnueabi-pkg-config --libs glib-2.0` arm-linux-gnueabi-gcc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/arm-linux-gnueabi/glib-2.0/include genewisedb.c -I../base/ -I../dynlibsrc/ -I../HMMer2/ genewisedb.c: In function ‘show_version’: genewisedb.c:1005:103: warning: macro "__DATE__" might prevent reproducible builds [-Wdate-time] 1005 | fprintf(ofp,"%s\nVersion: %s\nReleased: %s\nCompiled: %s\n",program_name,VERSION_NUMBER,RELEASE_DAY,COMPILE_DATE); | ^~~~~~~~~~~~ arm-linux-gnueabi-gcc -g -o genewisedb genewisedb.o geneparser21.o geneparameter.o genestats.o genewisehsp.o geneutil.o geneoutput.o threestatemodel.o genefrequency.o splicesitemodeler.o genewise4.o genewise6.o genestretch6.o genewise21.o geneloop21.o geneloop6.o genephase6.o gwlite.o gwlitemodel.o gwrap.o matchsum.o estwrap.o genewisemodel.o phasemodel.o cdparser.o genedisplay.o estwise3.o estslim3.o estloop3.o estfrag3.o estslimloop.o gwquickdb.o threestatedb.o pfamhmmer1db.o pwmdna.o wise2xhmmer2.o genewisemodeldb.o seqhit.o standardout.o geneparser4.o sw_wrap.o abc.o pba.o seqaligndisplay.o dbadisplay.o proteinsw.o estquick3.o -Wl,-z,relro -Wl,-z,now -L../base/ -L../dynlibsrc/ -L../HMMer2/ -lpthread `arm-linux-gnueabi-pkg-config --libs glib-2.0` -lhmmer -ldyna_glib -ldyna -lwisebase -lm -Wl,-z,relro -Wl,-z,now -L../base/ -L../dynlibsrc/ -L../HMMer2/ -lpthread `arm-linux-gnueabi-pkg-config --libs glib-2.0` arm-linux-gnueabi-gcc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/arm-linux-gnueabi/glib-2.0/include estwisedb.c -I../base/ -I../dynlibsrc/ -I../HMMer2/ estwisedb.c: In function ‘show_version’: estwisedb.c:838:103: warning: macro "__DATE__" might prevent reproducible builds [-Wdate-time] 838 | fprintf(ofp,"%s\nVersion: %s\nReleased: %s\nCompiled: %s\n",program_name,VERSION_NUMBER,RELEASE_DAY,COMPILE_DATE); | ^~~~~~~~~~~~ arm-linux-gnueabi-gcc -g -o estwisedb estwisedb.o geneparser21.o geneparameter.o genestats.o genewisehsp.o geneutil.o geneoutput.o threestatemodel.o genefrequency.o splicesitemodeler.o genewise4.o genewise6.o genestretch6.o genewise21.o geneloop21.o geneloop6.o genephase6.o gwlite.o gwlitemodel.o gwrap.o matchsum.o estwrap.o genewisemodel.o phasemodel.o cdparser.o genedisplay.o estwise3.o estslim3.o estloop3.o estfrag3.o estslimloop.o gwquickdb.o threestatedb.o pfamhmmer1db.o pwmdna.o wise2xhmmer2.o genewisemodeldb.o seqhit.o standardout.o geneparser4.o sw_wrap.o abc.o pba.o seqaligndisplay.o dbadisplay.o proteinsw.o estquick3.o -Wl,-z,relro -Wl,-z,now -L../base/ -L../dynlibsrc/ -L../HMMer2/ -lpthread `arm-linux-gnueabi-pkg-config --libs glib-2.0` -lhmmer -ldyna_glib -ldyna -lwisebase -lm -Wl,-z,relro -Wl,-z,now -L../base/ -L../dynlibsrc/ -L../HMMer2/ -lpthread `arm-linux-gnueabi-pkg-config --libs glib-2.0` arm-linux-gnueabi-gcc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/arm-linux-gnueabi/glib-2.0/include -I../base/ -I../dynlibsrc/ genomewise.c genomewise.c: In function ‘show_version’: genomewise.c:18:103: warning: macro "__DATE__" might prevent reproducible builds [-Wdate-time] 18 | fprintf(ofp,"%s\nVersion: %s\nReleased: %s\nCompiled: %s\n",program_name,VERSION_NUMBER,RELEASE_DAY,COMPILE_DATE); | ^~~~~~~~~~~~ arm-linux-gnueabi-gcc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/arm-linux-gnueabi/glib-2.0/include -I../base/ -I../dynlibsrc/ genomewise9.c arm-linux-gnueabi-gcc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/arm-linux-gnueabi/glib-2.0/include -I../base/ -I../dynlibsrc/ genome_evidence.c arm-linux-gnueabi-gcc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/arm-linux-gnueabi/glib-2.0/include -I../base/ -I../dynlibsrc/ est_evidence.c est_evidence.dy: In function ‘Wise2_new_est_GenomeEvidenceUnit’: est_evidence.dy:142:16: warning: assignment to ‘int (*)(void *)’ from incompatible pointer type ‘Wise2_EstEvidence * (*)(Wise2_EstEvidence *)’ [-Wincompatible-pointer-types] 142 | in->geu_free = free_EstEvidence; | ^ arm-linux-gnueabi-gcc -g -o genomewise genomewise.o genomewise9.o genome_evidence.o est_evidence.o geneoutput.o geneutil.o -Wl,-z,relro -Wl,-z,now -L../base/ -L../dynlibsrc/ -L../HMMer2/ -lpthread `arm-linux-gnueabi-pkg-config --libs glib-2.0` -ldyna_glib -ldyna -lwisebase -lm arm-linux-gnueabi-gcc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/arm-linux-gnueabi/glib-2.0/include -I../base/ -I../dynlibsrc/ sywise.c sywise.c: In function ‘show_version’: sywise.c:14:103: warning: macro "__DATE__" might prevent reproducible builds [-Wdate-time] 14 | fprintf(ofp,"%s\nVersion: %s\nReleased: %s\nCompiled: %s\n",program_name,VERSION_NUMBER,RELEASE_DAY,COMPILE_DATE); | ^~~~~~~~~~~~ arm-linux-gnueabi-gcc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/arm-linux-gnueabi/glib-2.0/include -I../base/ -I../dynlibsrc/ sywise20.c arm-linux-gnueabi-gcc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/arm-linux-gnueabi/glib-2.0/include -I../base/ -I../dynlibsrc/ syexonmodel.c arm-linux-gnueabi-gcc -g -o sywise sywise.o sywise20.o syexonmodel.o genestats.o pwmdna.o standardout.o geneutil.o -Wl,-z,relro -Wl,-z,now -L../base/ -L../dynlibsrc/ -L../HMMer2/ -lpthread `arm-linux-gnueabi-pkg-config --libs glib-2.0` -ldyna_glib -ldyna -lwisebase -lm arm-linux-gnueabi-gcc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/arm-linux-gnueabi/glib-2.0/include -I../base/ -I../dynlibsrc/ pseudowise.c pseudowise.c: In function ‘show_version’: pseudowise.c:15:103: warning: macro "__DATE__" might prevent reproducible builds [-Wdate-time] 15 | fprintf(ofp,"%s\nVersion: %s\nReleased: %s\nCompiled: %s\n",program_name,VERSION_NUMBER,RELEASE_DAY,COMPILE_DATE); | ^~~~~~~~~~~~ arm-linux-gnueabi-gcc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/arm-linux-gnueabi/glib-2.0/include -I../base/ -I../dynlibsrc/ pseudowise7.c arm-linux-gnueabi-gcc -g -o pseudowise pseudowise.o pseudowise7.o geneparser21.o geneparameter.o genestats.o genewisehsp.o geneutil.o geneoutput.o threestatemodel.o genefrequency.o splicesitemodeler.o genewise4.o genewise6.o genestretch6.o genewise21.o geneloop21.o geneloop6.o genephase6.o gwlite.o gwlitemodel.o gwrap.o matchsum.o estwrap.o genewisemodel.o phasemodel.o cdparser.o genedisplay.o estwise3.o estslim3.o estloop3.o estfrag3.o estslimloop.o gwquickdb.o threestatedb.o pfamhmmer1db.o pwmdna.o wise2xhmmer2.o genewisemodeldb.o seqhit.o standardout.o geneparser4.o sw_wrap.o abc.o pba.o seqaligndisplay.o dbadisplay.o proteinsw.o estquick3.o -Wl,-z,relro -Wl,-z,now -L../base/ -L../dynlibsrc/ -L../HMMer2/ -lpthread `arm-linux-gnueabi-pkg-config --libs glib-2.0` -lhmmer -ldyna_glib -ldyna -lwisebase -lm -Wl,-z,relro -Wl,-z,now -L../base/ -L../dynlibsrc/ -L../HMMer2/ -lpthread `arm-linux-gnueabi-pkg-config --libs glib-2.0` arm-linux-gnueabi-gcc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/arm-linux-gnueabi/glib-2.0/include -I../base/ -I../dynlibsrc/ `arm-linux-gnueabi-pkg-config --cflags glib-2.0` promoterwise.c promoterwise.c: In function ‘show_version’: promoterwise.c:17:103: warning: macro "__DATE__" might prevent reproducible builds [-Wdate-time] 17 | fprintf(ofp,"%s\nVersion: %s\nReleased: %s\nCompiled: %s\n",program_name,VERSION_NUMBER,RELEASE_DAY,COMPILE_DATE); | ^~~~~~~~~~~~ arm-linux-gnueabi-gcc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/arm-linux-gnueabi/glib-2.0/include -I../base/ -I../dynlibsrc/ localdba.c arm-linux-gnueabi-gcc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/arm-linux-gnueabi/glib-2.0/include -I../base/ -I../dynlibsrc/ `arm-linux-gnueabi-pkg-config --cflags glib-2.0` localcishit.c arm-linux-gnueabi-gcc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/arm-linux-gnueabi/glib-2.0/include -I../base/ -I../dynlibsrc/ localcispara.c arm-linux-gnueabi-gcc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/arm-linux-gnueabi/glib-2.0/include -I../base/ -I../dynlibsrc/ motifmatrix.c motifmatrix.c: In function ‘Wise2_MotifConsMatrix_alloc_matrix’: motifmatrix.c:408:24: warning: assignment to ‘char’ from ‘void *’ makes integer from pointer without a cast [-Wint-conversion] 408 | for(i=0;i>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/arm-linux-gnueabi/glib-2.0/include -I../base/ -I../dynlibsrc/ motifmatrixdp.c arm-linux-gnueabi-gcc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/arm-linux-gnueabi/glib-2.0/include -I../base/ -I../dynlibsrc/ transfactor.c transfactor.dy: In function ‘Wise2_read_ben_IUPAC_TransFactorSet’: transfactor.dy:680:21: warning: ‘%s’ directive writing up to 511 bytes into a region of size between 495 and 504 [-Wformat-overflow=] 680 | sprintf(sbuffer,"motif_%d_%s",motif_no,buffer); | ^~~~~~~~~~~~~ ~~~~~~ In file included from /usr/arm-linux-gnueabi/include/stdio.h:867, from ../base/wisebase.h:6, from pwmdna.h:6, from transfactor.h:6, from transfactor.c:4: /usr/arm-linux-gnueabi/include/bits/stdio2.h:36:10: note: ‘__builtin___sprintf_chk’ output between 9 and 529 bytes into a destination of size 512 36 | return __builtin___sprintf_chk (__s, __USE_FORTIFY_LEVEL - 1, | ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 37 | __bos (__s), __fmt, __va_arg_pack ()); | ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ arm-linux-gnueabi-gcc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/arm-linux-gnueabi/glib-2.0/include -I../base/ -I../dynlibsrc/ pairwiseshortdna.c arm-linux-gnueabi-gcc -g -o promoterwise promoterwise.o localdba.o localcishit.o localcispara.o dbadisplay.o motifmatrix.o motifmatrixdp.o transfactor.o pwmdna.o pairwiseshortdna.o -Wl,-z,relro -Wl,-z,now -L../base/ -L../dynlibsrc/ -L../HMMer2/ -lpthread `arm-linux-gnueabi-pkg-config --libs glib-2.0` -ldyna_glib -ldyna -lwisebase -lm `arm-linux-gnueabi-pkg-config --libs glib-2.0` -lpthread arm-linux-gnueabi-gcc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/arm-linux-gnueabi/glib-2.0/include -I../base/ -I../dynlibsrc/ -o scanwisep_wiseserver.o -DSCAN_WISESERVER -I../network -I../socket -I../external/mott scanwisep.c scanwisep.c: In function ‘show_version’: scanwisep.c:423:103: warning: macro "__DATE__" might prevent reproducible builds [-Wdate-time] 423 | fprintf(ofp,"%s\nVersion: %s\nReleased: %s\nCompiled: %s\n",program_name,VERSION_NUMBER,RELEASE_DAY,COMPILE_DATE); | ^~~~~~~~~~~~ arm-linux-gnueabi-gcc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/arm-linux-gnueabi/glib-2.0/include -I../base/ -I../dynlibsrc/ `arm-linux-gnueabi-pkg-config --cflags glib-2.0` hsp2aln_sw.c arm-linux-gnueabi-gcc -o scanwise scanwisep_wiseserver.o sw_wrap.o seqaligndisplay.o proteinsw.o abc.o pba.o hsp2aln_sw.o ../network/net_hspscan.o ../network/client_multihspscan.o -Wl,-z,relro -Wl,-z,now -L../base/ -L../dynlibsrc/ -L../HMMer2/ -lpthread `arm-linux-gnueabi-pkg-config --libs glib-2.0` -L../external/mott -L../socket -lmott -ldyna_glib -ldyna -lwisesocket -lwisebase -lm -lpthread -Wl,-z,relro -Wl,-z,now -L../base/ -L../dynlibsrc/ -L../HMMer2/ -lpthread `arm-linux-gnueabi-pkg-config --libs glib-2.0` ar ru libmodel.a geneparser21.o geneparameter.o genestats.o genewisehsp.o geneutil.o geneoutput.o threestatemodel.o genefrequency.o splicesitemodeler.o genewise4.o genewise6.o genestretch6.o genewise21.o geneloop21.o geneloop6.o genephase6.o gwlite.o gwlitemodel.o gwrap.o matchsum.o estwrap.o genewisemodel.o phasemodel.o cdparser.o genedisplay.o estwise3.o estslim3.o estloop3.o estfrag3.o estslimloop.o gwquickdb.o threestatedb.o pfamhmmer1db.o pwmdna.o wise2xhmmer2.o genewisemodeldb.o seqhit.o standardout.o geneparser4.o sw_wrap.o abc.o pba.o seqaligndisplay.o dbadisplay.o proteinsw.o estquick3.o ar: `u' modifier ignored since `D' is the default (see `U') ar: creating libmodel.a make[3]: Leaving directory '/<>/src/models' make bin make[3]: Entering directory '/<>/src' mkdir bin cp models/pswdb models/psw models/genewisedb models/estwisedb models/estwise models/genewise models/dba models/dnal models/promoterwise network/scanwise_server models/scanwise ./bin ./welcome.csh Welcome to Wise2.4 The executable programs are in the ./bin directory You must set your WISECONFIGDIR to the config directory before using the programs ie, type setenv WISECONFIGDIR /<>/src/../wisecfg/ to try an example, try cd example and then ../bin/genewise road.pep human.genomic to build perl, type make perl and follow the instructions to test the package, type make test make[3]: Leaving directory '/<>/src' make[2]: Leaving directory '/<>/src' /usr/bin/make -C debian/manpages.d make[2]: Entering directory '/<>/debian/manpages.d' docbook-to-man dba.sgml > dba.1 docbook-to-man dnal.sgml > dnal.1 docbook-to-man estwise.sgml > estwise.1 docbook-to-man estwisedb.sgml > estwisedb.1 docbook-to-man genewise.sgml > genewise.1 docbook-to-man genewisedb.sgml > genewisedb.1 docbook-to-man genomewise.sgml > genomewise.1 docbook-to-man promoterwise.sgml > promoterwise.1 docbook-to-man psw.sgml > psw.1 docbook-to-man pswdb.sgml > pswdb.1 docbook-to-man scanwise.sgml > scanwise.1 docbook-to-man scanwise_server.sgml > scanwise_server.1 make[2]: Leaving directory '/<>/debian/manpages.d' find src/models/ src/dynlibsrc/ -name '*.tex' -print0 | LC_ALL=C sort -z | xargs -0 cat | perl docs/gettex.pl > docs/temp.tex cat docs/wise2api.tex docs/temp.tex docs/apiend.tex > docs/api.tex sed -i 's/ sw_wrap / sw\\_wrap /' docs/api.tex sed -i 's/label{module_sequence\\_codon}/label{module_sequence_codon}/' docs/api.tex sed -i 's/Wise2::GeneParameter21_wrap/Wise2::GeneParameter21\\_wrap/' docs/api.tex cd docs && pdflatex api.tex This is pdfTeX, Version 3.14159265-2.6-1.40.21 (TeX Live 2020/Debian) (preloaded format=pdflatex) restricted \write18 enabled. entering extended mode (./api.tex LaTeX2e <2020-10-01> patch level 4 L3 programming layer <2021-01-09> xparse <2020-03-03> (/usr/share/texlive/texmf-dist/tex/latex/base/latex209.def Entering LaTeX 2.09 COMPATIBILITY MODE ************************************************************* !!WARNING!! !!WARNING!! !!WARNING!! !!WARNING!! This mode attempts to provide an emulation of the LaTeX 2.09 author environment so that OLD documents can be successfully processed. It should NOT be used for NEW documents! New documents should use Standard LaTeX conventions and start with the \documentclass command. Compatibility mode is UNLIKELY TO WORK with LaTeX 2.09 style files that change any internal macros, especially not with those that change the FONT SELECTION or OUTPUT ROUTINES. Therefore such style files MUST BE UPDATED to use Current Standard LaTeX: LaTeX2e. If you suspect that you may be using such a style file, which is probably very, very old by now, then you should attempt to get it updated by sending a copy of this error message to the author of that file. ************************************************************* (/usr/share/texlive/texmf-dist/tex/latex/base/tracefnt.sty) (/usr/share/texlive/texmf-dist/tex/latex/base/latexsym.sty)) (/usr/share/texlive/texmf-dist/tex/latex/base/article.cls Document Class: article 2020/04/10 v1.4m Standard LaTeX document class (/usr/share/texlive/texmf-dist/tex/latex/base/size10.clo)) (/usr/share/texlive/texmf-dist/tex/latex/l3backend/l3backend-pdftex.def) No file api.aux. (/usr/share/texlive/texmf-dist/tex/latex/base/ulasy.fd) [1{/var/lib/texmf/fonts /map/pdftex/updmap/pdftex.map}] No file api.toc. [2] [3] Overfull \hbox (1.49698pt too wide) in paragraph at lines 109--109 [] \OT1/cmtt/m/n/10 print "You must give a file to revcom for a reverse to w ork!";[] [4] [5] LaTeX Warning: Reference `object_CodonTable' on page 6 undefined on input line 198. LaTeX Warning: Reference `object_Sequence' on page 6 undefined on input line 19 9. LaTeX Warning: Reference `object_CompMat' on page 6 undefined on input line 205 . LaTeX Warning: Reference `object_Sequence' on page 6 undefined on input line 20 6. LaTeX Warning: Reference `object_Protein' on page 6 undefined on input line 207 . LaTeX Warning: Reference `object_CompMat' on page 6 undefined on input line 208 . LaTeX Warning: Reference `module_sw_wrap' on page 6 undefined on input line 209 . LaTeX Warning: Reference `module_seqaligndisplay' on page 6 undefined on input line 210. LaTeX Warning: Reference `object_Protein' on page 6 undefined on input line 215 . LaTeX Warning: Reference `object_Sequence' on page 6 undefined on input line 21 5. [6] LaTeX Warning: Reference `object_ProteinDB' on page 7 undefined on input line 2 16. LaTeX Warning: Reference `object_ProteinDB' on page 7 undefined on input line 2 17. LaTeX Warning: Reference `module_sw_wrap' on page 7 undefined on input line 218 . LaTeX Warning: Reference `object_Hscore' on page 7 undefined on input line 219. LaTeX Warning: Reference `object_DataEntry' on page 7 undefined on input line 2 21. LaTeX Warning: Reference `object_ProteinDB' on page 7 undefined on input line 2 21. LaTeX Warning: Reference `object_Sequence' on page 7 undefined on input line 22 8. LaTeX Warning: Reference `object_Protein' on page 7 undefined on input line 229 . LaTeX Warning: Reference `object_Sequence' on page 7 undefined on input line 23 0. LaTeX Warning: Reference `object_Genomic' on page 7 undefined on input line 231 . LaTeX Warning: Reference `object_GeneFrequency' on page 7 undefined on input li ne 233. LaTeX Warning: Reference `object_CodonTable' on page 7 undefined on input line 234. LaTeX Warning: Reference `object_RandomModelDNA' on page 7 undefined on input l ine 235. LaTeX Warning: Reference `module_gwrap' on page 7 undefined on input line 236. LaTeX Warning: Reference `module_gwrap' on page 7 undefined on input line 237. Overfull \hbox (21.30891pt too wide) in paragraph at lines 237--238 []\OT1/cmr/m/n/10 Build an en-tire pa-ram-e-ter set for ge-newise us-ing Wise2: :GeneParameter21[]wrap LaTeX Warning: Reference `module_gwrap' on page 7 undefined on input line 238. LaTeX Warning: Reference `module_gwrap' on page 7 undefined on input line 239. [7] [8] [9] LaTeX Warning: Reference `module_gwrap' on page 10 undefined on input line 389. [10] LaTeX Warning: Reference `module_estwrap' on page 11 undefined on input line 39 1. LaTeX Warning: Reference `module_sw_wrap' on page 11 undefined on input line 39 3. LaTeX Warning: Reference `module_genedisplay' on page 11 undefined on input lin e 395. LaTeX Warning: Reference `module_seqaligndisplay' on page 11 undefined on input line 397. LaTeX Warning: Reference `module_threestatemodel' on page 11 undefined on input line 399. LaTeX Warning: Reference `module_threestatedb' on page 11 undefined on input li ne 400. LaTeX Warning: Reference `module_genefrequency' on page 11 undefined on input l ine 401. LaTeX Warning: Reference `module_geneparameter' on page 11 undefined on input l ine 402. LaTeX Warning: Reference `module_cdparser' on page 11 undefined on input line 4 03. LaTeX Warning: Reference `module_sequence' on page 11 undefined on input line 4 10. LaTeX Warning: Reference `module_sequencedb' on page 11 undefined on input line 411. LaTeX Warning: Reference `module_protein' on page 11 undefined on input line 41 2. LaTeX Warning: Reference `module_proteindb' on page 11 undefined on input line 413. LaTeX Warning: Reference `module_genomic' on page 11 undefined on input line 41 4. LaTeX Warning: Reference `module_genomicdb' on page 11 undefined on input line 415. LaTeX Warning: Reference `module_cdna' on page 11 undefined on input line 416. LaTeX Warning: Reference `module_cdnadb' on page 11 undefined on input line 417 . LaTeX Warning: Reference `module_probability' on page 11 undefined on input lin e 423. LaTeX Warning: Reference `module_codon' on page 11 undefined on input line 424. LaTeX Warning: Reference `module_compmat' on page 11 undefined on input line 42 5. LaTeX Warning: Reference `module_codonmat' on page 11 undefined on input line 4 26. LaTeX Warning: Reference `module_codonmapper' on page 11 undefined on input lin e 427. [11] LaTeX Warning: Reference `module_hscore' on page 12 undefined on input line 433 . LaTeX Warning: Reference `module_histogram' on page 12 undefined on input line 434. LaTeX Warning: Reference `module_dbimpl' on page 12 undefined on input line 435 . LaTeX Warning: Reference `module_aln' on page 12 undefined on input line 441. LaTeX Warning: Reference `module_packaln' on page 12 undefined on input line 44 2. LaTeX Warning: Reference `module_basematrix' on page 12 undefined on input line 443. LaTeX Warning: Reference `object_AlnBlock' on page 12 undefined on input line 4 51. LaTeX Warning: Reference `object_AlnColumn' on page 12 undefined on input line 453. LaTeX Warning: Reference `object_AlnUnit' on page 12 undefined on input line 45 5. LaTeX Warning: Reference `object_AlnSequence' on page 12 undefined on input lin e 457. LaTeX Warning: Reference `accessing_fields' on page 12 undefined on input line 464. Overfull \hbox (6.8248pt too wide) in paragraph at lines 475--482 \OT1/cmr/m/n/10 AlnBlock is the main rep-re-sen-ta-tion of align-ments from Dy- na-mite. Each AlnBlock [12] (/usr/share/texlive/texmf-dist/tex/latex/base/ts1cmtt.fd) LaTeX Warning: Reference `accessing_fields' on page 13 undefined on input line 513. [13] LaTeX Warning: Reference `accessing_fields' on page 14 undefined on input line 555. [14] LaTeX Warning: Reference `accessing_fields' on page 15 undefined on input line 623. [15] LaTeX Warning: Reference `object_AlnRange' on page 16 undefined on input line 6 52. LaTeX Warning: Reference `object_AlnRangeSet' on page 16 undefined on input lin e 654. LaTeX Warning: Reference `accessing_fields' on page 16 undefined on input line 661. LaTeX Warning: Reference `accessing_fields' on page 16 undefined on input line 688. [16] LaTeX Warning: Reference `object_cDNA' on page 17 undefined on input line 741. LaTeX Warning: Reference `accessing_fields' on page 17 undefined on input line 748. [17] [18] [19] LaTeX Warning: Reference `object_cDNADB' on page 20 undefined on input line 884 . LaTeX Warning: Reference `accessing_fields' on page 20 undefined on input line 924. [20] LaTeX Warning: Reference `object_CodonTable' on page 21 undefined on input line 1005. [21] [22] [23] [24] LaTeX Warning: Reference `accessing_fields' on page 25 undefined on input line 1213. [25] [26] [27] LaTeX Warning: Reference `object_CodonMapper' on page 28 undefined on input lin e 1363. LaTeX Warning: Reference `accessing_fields' on page 28 undefined on input line 1391. [28] Overfull \hbox (12.33003pt too wide) in paragraph at lines 1418--1419 []\OT1/cmtt/m/n/10 &Wise2::CodonMapper::sprinkle[]errors[]over[]CodonMapper (cm ,error) LaTeX Warning: Reference `object_ComplexSequence' on page 29 undefined on input line 1442. LaTeX Warning: Reference `object_ComplexSequenceEvalSet' on page 29 undefined o n input line 1444. LaTeX Warning: Reference `accessing_fields' on page 29 undefined on input line 1451. [29] LaTeX Warning: Reference `accessing_fields' on page 30 undefined on input line 1482. LaTeX Warning: Reference `object_CompMat' on page 30 undefined on input line 15 17. LaTeX Warning: Reference `accessing_fields' on page 30 undefined on input line 1524. [30] [31] LaTeX Warning: Reference `object_DBSearchImpl' on page 32 undefined on input li ne 1624. [32] LaTeX Warning: Reference `accessing_fields' on page 33 undefined on input line 1671. [33] LaTeX Warning: Reference `object_DnaMatrix' on page 34 undefined on input line 1736. LaTeX Warning: Reference `object_DnaProbMatrix' on page 34 undefined on input l ine 1738. [34] LaTeX Warning: Reference `accessing_fields' on page 35 undefined on input line 1799. LaTeX Warning: Reference `accessing_fields' on page 35 undefined on input line 1812. [35] LaTeX Warning: Reference `object_Gene' on page 36 undefined on input line 1844. LaTeX Warning: Reference `accessing_fields' on page 36 undefined on input line 1851. [36] [37] LaTeX Warning: Reference `object_Genomic' on page 38 undefined on input line 19 48. LaTeX Warning: Reference `object_GenomicRepeat' on page 38 undefined on input l ine 1950. [38] Overfull \hbox (0.5938pt too wide) in paragraph at lines 1989--1990 []\OT1/cmtt/m/n/10 Wise2[]Genomic[]from[]Sequence[]Nheuristic (seq,length[]of[] N) LaTeX Warning: Reference `accessing_fields' on page 39 undefined on input line 2038. [39] [40] LaTeX Warning: Reference `accessing_fields' on page 41 undefined on input line 2150. [41] LaTeX Warning: Reference `object_GenomicDB' on page 42 undefined on input line 2168. Overfull \hbox (65.9032pt too wide) in paragraph at lines 2175--2176 []\OT1/cmtt/m/n/10 Wise2[]new[]GenomicDB[]from[]single[]seq (gen,cses,score[]in []repeat[]coding) Overfull \hbox (43.1997pt too wide) in paragraph at lines 2176--2177 []\OT1/cmtt/m/n/10 &Wise2::new[]GenomicDB[]from[]single[]seq (gen,cses,score[]i n[]repeat[]coding) Overfull \hbox (41.12343pt too wide) in paragraph at lines 2192--2193 []\OT1/cmtt/m/n/10 Wise2[]new[]GenomicDB (seqdb,cses,length[]of[]N,repeat[]in[] cds[]score) Overfull \hbox (18.41994pt too wide) in paragraph at lines 2193--2194 []\OT1/cmtt/m/n/10 &Wise2::new[]GenomicDB (seqdb,cses,length[]of[]N,repeat[]in[ ]cds[]score) [42] LaTeX Warning: Reference `accessing_fields' on page 43 undefined on input line 2213. [43] LaTeX Warning: Reference `object_GenomicRegion' on page 44 undefined on input l ine 2298. LaTeX Warning: Reference `accessing_fields' on page 44 undefined on input line 2305. [44] Overfull \hbox (1.83012pt too wide) in paragraph at lines 2348--2349 []\OT1/cmtt/m/n/10 &Wise2::GenomicRegion::read[]EMBL[]GenomicRegion[]file (file name) [45] Overfull \hbox (7.08008pt too wide) in paragraph at lines 2401--2402 []\OT1/cmtt/m/n/10 &Wise2::GenomicRegion::show[]ace[]GenomicRegion (gr,seq[]nam e,ofp) Overfull \hbox (3.5338pt too wide) in paragraph at lines 2426--2427 []\OT1/cmtt/m/n/10 Wise2[]show[]pretty[]GenomicRegion (gr,show[]supporting,ofp) Overfull \hbox (59.57962pt too wide) in paragraph at lines 2427--2428 []\OT1/cmtt/m/n/10 &Wise2::GenomicRegion::show[]pretty[]GenomicRegion (gr,show[ ]supporting,ofp) [46] [47] LaTeX Warning: Reference `object_Histogram' on page 48 undefined on input line 2505. [48] LaTeX Warning: Reference `accessing_fields' on page 49 undefined on input line 2553. Overfull \hbox (32.9967pt too wide) in paragraph at lines 2592--2592 [] \OT1/cmtt/m/n/10 b) cooperation with future versions of histogram.c would be possible.[] [49] [50] [51] Overfull \hbox (123.4428pt too wide) in paragraph at lines 2794--2795 []\OT1/cmtt/m/n/10 Wise2[]ExtremeValueSetHistogram (h,mu,lambda,lowbound,highbo und,wonka,ndegrees) Overfull \hbox (67.76958pt too wide) in paragraph at lines 2795--2796 []\OT1/cmtt/m/n/10 &Wise2::Histogram::set[]EVD (h,mu,lambda,lowbound,highbound, wonka,ndegrees) Overfull \hbox (33.66461pt too wide) in paragraph at lines 2797--2798 []\TS1/cmtt/m/n/10 $\OT1/cmtt/m/n/10 obj->set[]EVD(mu,lambda,lowbound,highbound ,wonka,ndegrees) [52] [53] [54] LaTeX Warning: Reference `object_Hscore' on page 55 undefined on input line 293 0. LaTeX Warning: Reference `object_DataScore' on page 55 undefined on input line 2932. LaTeX Warning: Reference `object_DataEntry' on page 55 undefined on input line 2934. LaTeX Warning: Reference `accessing_fields' on page 55 undefined on input line 2961. Overfull \hbox (30.97293pt too wide) in paragraph at lines 2971--2972 []\OT1/cmr/m/n/10 should[]store Type [boolean (*should[]store)(int given[]score ,double in-ter-nal[]score[]level) [55] [56] [57] LaTeX Warning: Reference `accessing_fields' on page 58 undefined on input line 3162. [58] LaTeX Warning: Reference `accessing_fields' on page 59 undefined on input line 3188. LaTeX Warning: Reference `object_PackAln' on page 59 undefined on input line 32 29. [59] LaTeX Warning: Reference `object_PackAlnUnit' on page 60 undefined on input lin e 3231. LaTeX Warning: Reference `accessing_fields' on page 60 undefined on input line 3238. [60] LaTeX Warning: Reference `accessing_fields' on page 61 undefined on input line 3308. [61] [62] LaTeX Warning: Reference `object_Protein' on page 63 undefined on input line 34 31. LaTeX Warning: Reference `accessing_fields' on page 63 undefined on input line 3438. [63] LaTeX Warning: Reference `object_ProteinDB' on page 64 undefined on input line 3488. LaTeX Warning: Reference `accessing_fields' on page 64 undefined on input line 3545. [64] LaTeX Warning: Reference `object_RandomProteinDB' on page 65 undefined on input line 3590. LaTeX Warning: Reference `object_RandomDNADB' on page 65 undefined on input lin e 3592. LaTeX Warning: Reference `accessing_fields' on page 65 undefined on input line 3599. LaTeX Warning: Reference `accessing_fields' on page 65 undefined on input line 3620. [65] LaTeX Warning: Reference `object_RandomModelDNA' on page 66 undefined on input line 3642. LaTeX Warning: Reference `object_RandomModel' on page 66 undefined on input lin e 3644. LaTeX Warning: Reference `accessing_fields' on page 66 undefined on input line 3682. [66] LaTeX Warning: Reference `accessing_fields' on page 67 undefined on input line 3697. LaTeX Warning: Reference `object_Sequence' on page 67 undefined on input line 3 713. LaTeX Warning: Reference `object_SequenceSet' on page 67 undefined on input lin e 3715. [67] LaTeX Warning: Reference `accessing_fields' on page 68 undefined on input line 3779. [68] Overfull \hbox (16.34366pt too wide) in paragraph at lines 3839--3840 []\OT1/cmtt/m/n/10 Wise2[]force[]to[]dna[]Sequence (seq,fraction,number[]of[]co nver) [69] [70] [71] [72] [73] [74] LaTeX Warning: Reference `accessing_fields' on page 75 undefined on input line 4176. [75] [76] LaTeX Warning: Reference `object_SequenceDB' on page 77 undefined on input line 4265. LaTeX Warning: Reference `object_FileSource' on page 77 undefined on input line 4267. LaTeX Warning: Reference `accessing_fields' on page 77 undefined on input line 4294. [77] LaTeX Warning: Reference `accessing_fields' on page 78 undefined on input line 4355. LaTeX Warning: Reference `object_Exon' on page 78 undefined on input line 4381. LaTeX Warning: Reference `object_Transcript' on page 78 undefined on input line 4383. [78] LaTeX Warning: Reference `accessing_fields' on page 79 undefined on input line 4390. LaTeX Warning: Reference `accessing_fields' on page 79 undefined on input line 4413. [79] LaTeX Warning: Reference `object_Translation' on page 80 undefined on input lin e 4482. LaTeX Warning: Reference `accessing_fields' on page 80 undefined on input line 4489. Overfull \hbox (24.01358pt too wide) in paragraph at lines 4508--4515 \OT1/cmr/m/n/10 have any se-quence in it. When se-quence is asked for by get[]P rotein[]from[]Translation() [80] LaTeX Warning: Reference `object_cDNAParser' on page 81 undefined on input line 4549. [81] LaTeX Warning: Reference `accessing_fields' on page 82 undefined on input line 4579. LaTeX Warning: Reference `object_DnaStartEnd' on page 82 undefined on input lin e 4602. Overfull \hbox (62.7533pt too wide) in paragraph at lines 4609--4610 []\OT1/cmtt/m/n/10 Wise2[]make[]align[]dnaalign (one,two,mat,se,qgap,qext,tgap, text,dpri) Overfull \hbox (40.0498pt too wide) in paragraph at lines 4610--4611 []\OT1/cmtt/m/n/10 &Wise2::make[]align[]dnaalign (one,two,mat,se,qgap,qext,tgap ,text,dpri) [82] LaTeX Warning: Reference `accessing_fields' on page 83 undefined on input line 4655. Overfull \hbox (335.96082pt too wide) in paragraph at lines 4671--4672 []\OT1/cmtt/m/n/10 Wise2[]Hscore[]from[]TSM[]estwise (tdb,cdb,cp,cm,rmd,use[]sy n,alg,bits[]cutoff,allN,flat[]insert,report[]level,die[]on[]error,dbsi) Overfull \hbox (313.25732pt too wide) in paragraph at lines 4672--4673 []\OT1/cmtt/m/n/10 &Wise2::Hscore[]from[]TSM[]estwise (tdb,cdb,cp,cm,rmd,use[]s yn,alg,bits[]cutoff,allN,flat[]insert,report[]level,die[]on[]error,dbsi) [83] Overfull \hbox (329.87091pt too wide) in paragraph at lines 4698--4699 []\OT1/cmtt/m/n/10 Wise2[]AlnBlock[]from[]Protein[]estwise[]wrap (pro,cdna,cp,c m,ct,comp,gap,ext,is[]global,rmd,alg,rm,use[]syn,allN,dpri,palpoi) Overfull \hbox (270.41774pt too wide) in paragraph at lines 4699--4700 []\OT1/cmtt/m/n/10 &Wise2::AlnBlock[]from[]Protein[]estwise[]wrap (pro,cdna,cp, cm,ct,comp,gap,ext,is[]global,rmd,alg,rm,use[]syn,allN,dpri) [84] Overfull \hbox (265.40146pt too wide) in paragraph at lines 4732--4733 []\OT1/cmtt/m/n/10 Wise2[]AlnBlock[]from[]TSM[]estwise[]wrap (tsm,cdna,cp,cm,ct ,rmd,alg,use[]syn,force[]flat[]insert,allN,dpri,palpoi) Overfull \hbox (205.94829pt too wide) in paragraph at lines 4733--4734 []\OT1/cmtt/m/n/10 &Wise2::AlnBlock[]from[]TSM[]estwise[]wrap (tsm,cdna,cp,cm,c t,rmd,alg,use[]syn,force[]flat[]insert,allN,dpri) [85] Overfull \hbox (47.00343pt too wide) in paragraph at lines 4780--4781 []\OT1/cmtt/m/n/10 Wise2[]protein2genomic[]ascii[]display (alb,p,gen,ct,name,ma in,ofp) Overfull \hbox (24.29994pt too wide) in paragraph at lines 4781--4782 []\OT1/cmtt/m/n/10 &Wise2::protein2genomic[]ascii[]display (alb,p,gen,ct,name,m ain,ofp) [86] Overfull \hbox (188.7522pt too wide) in paragraph at lines 4801--4802 []\OT1/cmtt/m/n/10 Wise2[]protcdna[]ascii[]display (alb,protsequence,protname,p rotoff,cdna,ct,name,main,mult,ofp) Overfull \hbox (166.0487pt too wide) in paragraph at lines 4802--4803 []\OT1/cmtt/m/n/10 &Wise2::protcdna[]ascii[]display (alb,protsequence,protname, protoff,cdna,ct,name,main,mult,ofp) LaTeX Warning: Reference `object_GeneFrequency21' on page 87 undefined on input line 4830. LaTeX Warning: Reference `object_GeneConsensus' on page 87 undefined on input l ine 4832. LaTeX Warning: Reference `object_GeneSingleCons' on page 87 undefined on input line 4834. [87] LaTeX Warning: Reference `accessing_fields' on page 88 undefined on input line 4879. Overfull \hbox (1.40793pt too wide) in paragraph at lines 4893--4894 []\OT1/cmr/m/n/10 transition[GENEFREQUENCY21[]TRANSITION[]LEN] Type [dou-ble : Scalar] LaTeX Warning: Reference `accessing_fields' on page 88 undefined on input line 4906. [88] LaTeX Warning: Reference `accessing_fields' on page 89 undefined on input line 4921. LaTeX Warning: Reference `object_GeneParameter21' on page 89 undefined on input line 4937. LaTeX Warning: Reference `accessing_fields' on page 89 undefined on input line 4944. [89] LaTeX Warning: Reference `object_MatchSummarySet' on page 90 undefined on input line 4990. LaTeX Warning: Reference `object_MatchSummary' on page 90 undefined on input li ne 4992. LaTeX Warning: Reference `accessing_fields' on page 90 undefined on input line 4999. Overfull \hbox (71.7832pt too wide) in paragraph at lines 5014--5015 []\OT1/cmtt/m/n/10 Wise2[]MatchSummarySet[]from[]AlnBlock[]estwise (alb,qname,o ffset,target) Overfull \hbox (1.83012pt too wide) in paragraph at lines 5015--5016 []\OT1/cmtt/m/n/10 &Wise2::MatchSummarySet::MatchSummarySet[]from[]AlnBlock[]es twise Overfull \hbox (62.22433pt too wide) in paragraph at lines 5017--5018 []\TS1/cmtt/m/n/10 $\OT1/cmtt/m/n/10 obj->MatchSummarySet[]from[]AlnBlock[]estw ise(qname,offset,target) [90] Overfull \hbox (82.28311pt too wide) in paragraph at lines 5040--5041 []\OT1/cmtt/m/n/10 Wise2[]MatchSummarySet[]from[]AlnBlock[]genewise (alb,qname, protoff,target) Overfull \hbox (7.08008pt too wide) in paragraph at lines 5041--5042 []\OT1/cmtt/m/n/10 &Wise2::MatchSummarySet::MatchSummarySet[]from[]AlnBlock[]ge newise Overfull \hbox (72.72424pt too wide) in paragraph at lines 5043--5044 []\TS1/cmtt/m/n/10 $\OT1/cmtt/m/n/10 obj->MatchSummarySet[]from[]AlnBlock[]gene wise(qname,protoff,target) LaTeX Warning: Reference `accessing_fields' on page 91 undefined on input line 5065. [91] LaTeX Warning: Reference `object_PfamHmmer1DB' on page 92 undefined on input li ne 5107. LaTeX Warning: Reference `object_PfamHmmer1Entry' on page 92 undefined on input line 5109. LaTeX Warning: Reference `accessing_fields' on page 92 undefined on input line 5116. LaTeX Warning: Reference `accessing_fields' on page 92 undefined on input line 5152. [92] Overfull \hbox (92.78302pt too wide) in paragraph at lines 5174--5175 []\OT1/cmtt/m/n/10 Wise2[]write[]pretty[]str[]align (alb,qname,query,tname,targ et,name,main,ofp) Overfull \hbox (70.07953pt too wide) in paragraph at lines 5175--5176 []\OT1/cmtt/m/n/10 &Wise2::write[]pretty[]str[]align (alb,qname,query,tname,tar get,name,main,ofp) [93] Overfull \hbox (3.5338pt too wide) in paragraph at lines 5217--5218 []\OT1/cmtt/m/n/10 Wise2[]write[]pretty[]Protein[]align (alb,q,t,name,main,ofp) LaTeX Warning: Reference `object_DnaSequenceHitList' on page 94 undefined on in put line 5243. LaTeX Warning: Reference `object_SegmentHitList' on page 94 undefined on input line 5245. LaTeX Warning: Reference `object_SegmentHit' on page 94 undefined on input line 5247. [94] LaTeX Warning: Reference `accessing_fields' on page 95 undefined on input line 5254. Overfull \hbox (29.5499pt too wide) in paragraph at lines 5290--5291 []\OT1/cmtt/m/n/10 &Wise2::DnaSequenceHitList::read[]MSPcrunch[]DnaSequenceHitL ist (ifp) [95] LaTeX Warning: Reference `accessing_fields' on page 96 undefined on input line 5307. LaTeX Warning: Reference `accessing_fields' on page 96 undefined on input line 5320. Overfull \hbox (99.50298pt too wide) in paragraph at lines 5348--5349 []\OT1/cmtt/m/n/10 Wise2[]Align[]strings[]ProteinSmithWaterman (one,two,comp,ga p,ext,dpenv,dpri) Overfull \hbox (76.79948pt too wide) in paragraph at lines 5349--5350 []\OT1/cmtt/m/n/10 &Wise2::Align[]strings[]ProteinSmithWaterman (one,two,comp,g ap,ext,dpenv,dpri) [96] Overfull \hbox (110.00288pt too wide) in paragraph at lines 5373--5374 []\OT1/cmtt/m/n/10 Wise2[]Align[]Sequences[]ProteinSmithWaterman (one,two,comp, gap,ext,dpenv,dpri) Overfull \hbox (87.2994pt too wide) in paragraph at lines 5374--5375 []\OT1/cmtt/m/n/10 &Wise2::Align[]Sequences[]ProteinSmithWaterman (one,two,comp ,gap,ext,dpenv,dpri) Overfull \hbox (7.58401pt too wide) in paragraph at lines 5386--5387 []\OT1/cmr/m/n/10 [OWNER] new AlnBlock struc-ture rep-re-sent-ing the align-men t [AlnBlock [97] Overfull \hbox (68.00325pt too wide) in paragraph at lines 5407--5408 []\OT1/cmtt/m/n/10 Wise2[]Align[]Proteins[]SmithWaterman (one,two,comp,gap,ext, dpenv,dpri) Overfull \hbox (45.29976pt too wide) in paragraph at lines 5408--5409 []\OT1/cmtt/m/n/10 &Wise2::Align[]Proteins[]SmithWaterman (one,two,comp,gap,ext ,dpenv,dpri) Overfull \hbox (5.0038pt too wide) in paragraph at lines 5434--5435 []\OT1/cmtt/m/n/10 Wise2[]Align[]Proteins[]ABC (one,two,comp,a,b,c,dpenv,dpri) [98] Overfull \hbox (47.00343pt too wide) in paragraph at lines 5455--5456 []\OT1/cmtt/m/n/10 Wise2[]Align[]Sequences[]ProteinABC (one,two,comp,a,b,c,dpen v,dpri) Overfull \hbox (24.29994pt too wide) in paragraph at lines 5456--5457 []\OT1/cmtt/m/n/10 &Wise2::Align[]Sequences[]ProteinABC (one,two,comp,a,b,c,dpe nv,dpri) Overfull \hbox (86.01088pt too wide) in paragraph at lines 5471--5474 \OT1/cmr/m/n/10 Align[]Sequences[]ProteinABC this func-tion is anal-o-gous to A lign[]Sequences[]ProteinSmithWaterman Overfull \hbox (240.62169pt too wide) in paragraph at lines 5478--5479 []\OT1/cmtt/m/n/10 Wise2[]Hscore[]from[]ProteinSW (querydb,targetdb,comp,gap,ex t,bits[]cutoff,report[]level,die[]on[]error,dbsi) Overfull \hbox (217.9182pt too wide) in paragraph at lines 5479--5480 []\OT1/cmtt/m/n/10 &Wise2::Hscore[]from[]ProteinSW (querydb,targetdb,comp,gap,e xt,bits[]cutoff,report[]level,die[]on[]error,dbsi) [99] Overfull \hbox (235.37173pt too wide) in paragraph at lines 5500--5501 []\OT1/cmtt/m/n/10 Wise2[]Hscore[]from[]ProteinABC (querydb,targetdb,comp,a,b,c ,bits[]cutoff,report[]level,die[]on[]error,dbsi) Overfull \hbox (212.66824pt too wide) in paragraph at lines 5501--5502 []\OT1/cmtt/m/n/10 &Wise2::Hscore[]from[]ProteinABC (querydb,targetdb,comp,a,b, c,bits[]cutoff,report[]level,die[]on[]error,dbsi) [100] Overfull \hbox (359.90063pt too wide) in paragraph at lines 5523--5524 []\OT1/cmtt/m/n/10 Wise2[]Hscore[]from[]ProteinBA (querydb,targetdb,comp,bentry ,bexit,bfor[]trans,b[]self[]trans,b3exit,bits[]cutoff,report[]level,dbsi) Overfull \hbox (337.19714pt too wide) in paragraph at lines 5524--5525 []\OT1/cmtt/m/n/10 &Wise2::Hscore[]from[]ProteinBA (querydb,targetdb,comp,bentr y,bexit,bfor[]trans,b[]self[]trans,b3exit,bits[]cutoff,report[]level,dbsi) LaTeX Warning: Reference `object_ThreeStateDB' on page 101 undefined on input l ine 5552. LaTeX Warning: Reference `accessing_fields' on page 101 undefined on input line 5559. [101] Overfull \hbox (15.42177pt too wide) in paragraph at lines 5587--5588 []\OT1/cmr/m/n/10 reload[]generic Type [Three-State-Model * (*reload[]generic)( ThreeStateDB * tdb,int Overfull \hbox (3.42192pt too wide) in paragraph at lines 5594--5595 []\OT1/cmr/m/n/10 dataentry[]add Type [boolean (*dataen-try[]add)(ThreeStateDB * tdb,DataEntry Overfull \hbox (41.78299pt too wide) in paragraph at lines 5598--5599 []\OT1/cmr/m/n/10 index[]generic Type [Three-State-Model * (*in-dex[]generic)(T hreeStateDB *tdb,DataEntry [102] Overfull \hbox (29.5499pt too wide) in paragraph at lines 5669--5670 []\OT1/cmtt/m/n/10 &Wise2::ThreeStateDB::new[]proteindb[]ThreeStateDB (sdb,comp ,gap,ext) [103] [104] LaTeX Warning: Reference `object_ThreeStateModel' on page 105 undefined on inpu t line 5732. LaTeX Warning: Reference `object_ThreeStateUnit' on page 105 undefined on input line 5734. LaTeX Warning: Reference `accessing_fields' on page 105 undefined on input line 5775. [105] Overfull \hbox (16.10999pt too wide) in paragraph at lines 5802--5803 []\OT1/cmtt/m/n/10 &Wise2::ThreeStateModel::force[]global[]model (tsm,prob[]int o[]model) Overfull \hbox (102.65288pt too wide) in paragraph at lines 5822--5823 []\OT1/cmtt/m/n/10 Wise2[]force[]weighted[]local[]model (tsm,prob[]into[]model, ratio[]start,ratio[]end) Overfull \hbox (169.19861pt too wide) in paragraph at lines 5823--5824 []\OT1/cmtt/m/n/10 &Wise2::ThreeStateModel::force[]weighted[]local[]model (tsm, prob[]into[]model,ratio[]start,ratio[]end) Overfull \hbox (93.09401pt too wide) in paragraph at lines 5825--5826 []\TS1/cmtt/m/n/10 $\OT1/cmtt/m/n/10 obj->force[]weighted[]local[]model(prob[]i nto[]model,ratio[]start,ratio[]end) Overfull \hbox (49.31339pt too wide) in paragraph at lines 5845--5846 []\OT1/cmtt/m/n/10 Wise2[]ThreeStateModel[]from[]half[]bit[]Sequence (pro,mat,r m,gap,ext) [106] Overfull \hbox (5.61008pt too wide) in paragraph at lines 5846--5847 []\OT1/cmtt/m/n/10 &Wise2::ThreeStateModel::ThreeStateModel[]from[]half[]bit[]S equence Overfull \hbox (39.75452pt too wide) in paragraph at lines 5848--5849 []\TS1/cmtt/m/n/10 $\OT1/cmtt/m/n/10 obj->ThreeStateModel[]from[]half[]bit[]Seq uence(mat,rm,gap,ext) Overfull \hbox (51.38966pt too wide) in paragraph at lines 5872--5873 []\OT1/cmtt/m/n/10 &Wise2::ThreeStateModel::write[]HMMer[]1[]7[]ascii[]ThreeSta teModel (tsm,ofp) LaTeX Warning: Reference `accessing_fields' on page 107 undefined on input line 5890. [107] [108] (./api.aux) kpathsea: Running mktexpk --mfmode / --bdpi 600 --mag 1+0/600 --dpi 600 tctt1000 mkdir: cannot create directory ‘././sbuild-nonexistent’: Permission denied mktexpk: Running mf-nowin -progname=mf \mode:=ljfour; mag:=1+0/600; nonstopmode; input tctt1000 This is METAFONT, Version 2.7182818 (TeX Live 2020/Debian) (preloaded base=mf) (/usr/share/texlive/texmf-dist/fonts/source/jknappen/ec/tctt1000.mf (/usr/share/texlive/texmf-dist/fonts/source/jknappen/ec/exbase.mf) (/usr/share/texlive/texmf-dist/fonts/source/jknappen/ec/tctt.mf (/usr/share/texlive/texmf-dist/fonts/source/jknappen/ec/txsymb.mf Ok (/usr/share/texlive/texmf-dist/fonts/source/jknappen/ec/exaccess.mf Ok) (/usr/share/texlive/texmf-dist/fonts/source/jknappen/ec/txpseudo.mf Ok) (/usr/share/texlive/texmf-dist/fonts/source/jknappen/ec/txaccent.mf Ok [0] [1] [2] [3] [4] [5] [6] [7] [8] [9] [10] [11] [12] [27] [29]) (/usr/share/texlive/texmf-dist/fonts/source/jknappen/ec/txgen.mf Ok [100] [109] [98] [99] [108]) (/usr/share/texlive/texmf-dist/fonts/source/jknappen/ec/txsymbol.mf Ok [13] [18] [21] [22] [23] [24] [25] [26] [28] [31] [32] [36] [39] [44] [45] [46] [42] [47] [60] [61] [62] [77] [79] [87] [110] [91] [93] [94] [95] [96] [126] [127] [128] [129] [130] [131] [132] [133] [134] [135] [136] [137] [138] [139] [140] [141] [142] [143] [144] [145] [146] [147] [148] [149] [150] [151] [152] [153] [154] [155] [156] [157] [158] [159] [160] [161] [162] [163] [164] [165] [166] [167] [168] [169] [171] [172] [173] [174] [175] [177] [176] [180] [181] [182] [183] [184] [187] [191] [214] [246]) (/usr/share/texlive/texmf-dist/fonts/source/jknappen/ec/txromod.mf Ok [48] [49] [50] [51] [52] [53] [54] [55] [56] [57]) (/usr/share/texlive/texmf-dist/fonts/source/jknappen/ec/txrsuper.mf Ok [185] [178] [179] [170] [186]) (/usr/share/texlive/texmf-dist/fonts/source/jknappen/ec/txrfract.mf Ok [188] [189] [190]) ) ) ) Font metrics written on tctt1000.tfm. Output written on tctt1000.600gf (128 characters, 19540 bytes). Transcript written on tctt1000.log. mktexpk: /tmp/texfonts/pk/ljfour/jknappen/ec/tctt1000.600pk: successfully generated. LaTeX Warning: There were undefined references. LaTeX Warning: Label(s) may have changed. Rerun to get cross-references right. ) (see the transcript file for additional information) kpathsea: Running mktexpk --mfmode / --bdpi 600 --mag 1+0/600 --dpi 600 tcrm1000 mkdir: cannot create directory ‘././sbuild-nonexistent’: Permission denied mktexpk: Running mf-nowin -progname=mf \mode:=ljfour; mag:=1+0/600; nonstopmode; input tcrm1000 This is METAFONT, Version 2.7182818 (TeX Live 2020/Debian) (preloaded base=mf) (/usr/share/texlive/texmf-dist/fonts/source/jknappen/ec/tcrm1000.mf (/usr/share/texlive/texmf-dist/fonts/source/jknappen/ec/exbase.mf) (/usr/share/texlive/texmf-dist/fonts/source/jknappen/ec/tcrm.mf (/usr/share/texlive/texmf-dist/fonts/source/jknappen/ec/txsymb.mf Ok (/usr/share/texlive/texmf-dist/fonts/source/jknappen/ec/exaccess.mf Ok) (/usr/share/texlive/texmf-dist/fonts/source/jknappen/ec/txpseudo.mf Ok) (/usr/share/texlive/texmf-dist/fonts/source/jknappen/ec/txaccent.mf Ok [0] [1] [2] [3] [4] [5] [6] [7] [8] [9] [10] [11] [12] [27] [29]) (/usr/share/texlive/texmf-dist/fonts/source/jknappen/ec/txgen.mf Ok [100] [109] [98] [99] [108]) (/usr/share/texlive/texmf-dist/fonts/source/jknappen/ec/txsymbol.mf Ok [13] [18] [21] [22] [23] [24] [25] [26] [28] [31] [32] [36] [39] [44] [45] [46] [42] [47] [60] [61] [62] [77] [79] [87] [110] [91] [93] [94] [95] [96] [126] [127] [128] [129] [130] [131] [132] [133] [134] [135] [136] [137] [138] [139] [140] [141] [142] [143] [144] [145] [146] [147] [148] [149] [150] [151] [152] [153] [154] [155] [156] [157] [158] [159] [160] [161] [162] [163] [164] [165] [166] [167] [168] [169] [171] [172] [173] [174] [175] [177] [176] [180] [181] [182] [183] [184] [187] [191] [214] [246]) (/usr/share/texlive/texmf-dist/fonts/source/jknappen/ec/txromod.mf Ok [48] [49] [50] [51] [52] [53] [54] [55] [56] [57]) (/usr/share/texlive/texmf-dist/fonts/source/jknappen/ec/txrsuper.mf Ok [185] [178] [179] [170] [186]) (/usr/share/texlive/texmf-dist/fonts/source/jknappen/ec/txrfract.mf Ok [188] [189] [190]) ) ) ) (some charht values had to be adjusted by as much as 0.06943pt) Font metrics written on tcrm1000.tfm. Output written on tcrm1000.600gf (128 characters, 23548 bytes). Transcript written on tcrm1000.log. mktexpk: /tmp/texfonts/pk/ljfour/jknappen/ec/tcrm1000.600pk: successfully generated. Output written on api.pdf (108 pages, 298400 bytes). Transcript written on api.log. cd docs && pdflatex api.tex This is pdfTeX, Version 3.14159265-2.6-1.40.21 (TeX Live 2020/Debian) (preloaded format=pdflatex) restricted \write18 enabled. entering extended mode (./api.tex LaTeX2e <2020-10-01> patch level 4 L3 programming layer <2021-01-09> xparse <2020-03-03> (/usr/share/texlive/texmf-dist/tex/latex/base/latex209.def Entering LaTeX 2.09 COMPATIBILITY MODE ************************************************************* !!WARNING!! !!WARNING!! !!WARNING!! !!WARNING!! This mode attempts to provide an emulation of the LaTeX 2.09 author environment so that OLD documents can be successfully processed. It should NOT be used for NEW documents! New documents should use Standard LaTeX conventions and start with the \documentclass command. Compatibility mode is UNLIKELY TO WORK with LaTeX 2.09 style files that change any internal macros, especially not with those that change the FONT SELECTION or OUTPUT ROUTINES. Therefore such style files MUST BE UPDATED to use Current Standard LaTeX: LaTeX2e. If you suspect that you may be using such a style file, which is probably very, very old by now, then you should attempt to get it updated by sending a copy of this error message to the author of that file. ************************************************************* (/usr/share/texlive/texmf-dist/tex/latex/base/tracefnt.sty) (/usr/share/texlive/texmf-dist/tex/latex/base/latexsym.sty)) (/usr/share/texlive/texmf-dist/tex/latex/base/article.cls Document Class: article 2020/04/10 v1.4m Standard LaTeX document class (/usr/share/texlive/texmf-dist/tex/latex/base/size10.clo)) (/usr/share/texlive/texmf-dist/tex/latex/l3backend/l3backend-pdftex.def) (./api.aux) (/usr/share/texlive/texmf-dist/tex/latex/base/ulasy.fd) [1{/var/lib /texmf/fonts/map/pdftex/updmap/pdftex.map}] (./api.toc [2] [3] [4] [5] [6] [7] [8] [9]) [10] [11] Overfull \hbox (1.49698pt too wide) in paragraph at lines 109--109 [] \OT1/cmtt/m/n/10 print "You must give a file to revcom for a reverse to w ork!";[] [12] [13] [14] LaTeX Warning: Reference `object_GeneFrequency' on page 15 undefined on input l ine 233. LaTeX Warning: Reference `module_gwrap' on page 15 undefined on input line 236. LaTeX Warning: Reference `module_gwrap' on page 15 undefined on input line 237. Overfull \hbox (21.30891pt too wide) in paragraph at lines 237--238 []\OT1/cmr/m/n/10 Build an en-tire pa-ram-e-ter set for ge-newise us-ing Wise2: :GeneParameter21[]wrap LaTeX Warning: Reference `module_gwrap' on page 15 undefined on input line 238. LaTeX Warning: Reference `module_gwrap' on page 15 undefined on input line 239. [15] [16] [17] LaTeX Warning: Reference `module_gwrap' on page 18 undefined on input line 389. [18] LaTeX Warning: Reference `module_codonmat' on page 19 undefined on input line 4 26. [19] LaTeX Warning: Reference `module_dbimpl' on page 20 undefined on input line 435 . Overfull \hbox (6.8248pt too wide) in paragraph at lines 475--482 \OT1/cmr/m/n/10 AlnBlock is the main rep-re-sen-ta-tion of align-ments from Dy- na-mite. Each AlnBlock [20] (/usr/share/texlive/texmf-dist/tex/latex/base/ts1cmtt.fd) [21] [22] [23] [24] [25] [26] [27] [28] [29] [30] [31] [32] [33] [34] [35] [36] Overfull \hbox (12.33003pt too wide) in paragraph at lines 1418--1419 []\OT1/cmtt/m/n/10 &Wise2::CodonMapper::sprinkle[]errors[]over[]CodonMapper (cm ,error) [37] [38] [39] [40] [41] [42] [43] [44] [45] [46] Overfull \hbox (0.5938pt too wide) in paragraph at lines 1989--1990 []\OT1/cmtt/m/n/10 Wise2[]Genomic[]from[]Sequence[]Nheuristic (seq,length[]of[] N) [47] [48] [49] Overfull \hbox (65.9032pt too wide) in paragraph at lines 2175--2176 []\OT1/cmtt/m/n/10 Wise2[]new[]GenomicDB[]from[]single[]seq (gen,cses,score[]in []repeat[]coding) Overfull \hbox (43.1997pt too wide) in paragraph at lines 2176--2177 []\OT1/cmtt/m/n/10 &Wise2::new[]GenomicDB[]from[]single[]seq (gen,cses,score[]i n[]repeat[]coding) Overfull \hbox (41.12343pt too wide) in paragraph at lines 2192--2193 []\OT1/cmtt/m/n/10 Wise2[]new[]GenomicDB (seqdb,cses,length[]of[]N,repeat[]in[] cds[]score) Overfull \hbox (18.41994pt too wide) in paragraph at lines 2193--2194 []\OT1/cmtt/m/n/10 &Wise2::new[]GenomicDB (seqdb,cses,length[]of[]N,repeat[]in[ ]cds[]score) [50] [51] [52] Overfull \hbox (1.83012pt too wide) in paragraph at lines 2348--2349 []\OT1/cmtt/m/n/10 &Wise2::GenomicRegion::read[]EMBL[]GenomicRegion[]file (file name) [53] Overfull \hbox (7.08008pt too wide) in paragraph at lines 2401--2402 []\OT1/cmtt/m/n/10 &Wise2::GenomicRegion::show[]ace[]GenomicRegion (gr,seq[]nam e,ofp) Overfull \hbox (3.5338pt too wide) in paragraph at lines 2426--2427 []\OT1/cmtt/m/n/10 Wise2[]show[]pretty[]GenomicRegion (gr,show[]supporting,ofp) Overfull \hbox (59.57962pt too wide) in paragraph at lines 2427--2428 []\OT1/cmtt/m/n/10 &Wise2::GenomicRegion::show[]pretty[]GenomicRegion (gr,show[ ]supporting,ofp) [54] [55] [56] Overfull \hbox (32.9967pt too wide) in paragraph at lines 2592--2592 [] \OT1/cmtt/m/n/10 b) cooperation with future versions of histogram.c would be possible.[] [57] [58] [59] Overfull \hbox (123.4428pt too wide) in paragraph at lines 2794--2795 []\OT1/cmtt/m/n/10 Wise2[]ExtremeValueSetHistogram (h,mu,lambda,lowbound,highbo und,wonka,ndegrees) Overfull \hbox (67.76958pt too wide) in paragraph at lines 2795--2796 []\OT1/cmtt/m/n/10 &Wise2::Histogram::set[]EVD (h,mu,lambda,lowbound,highbound, wonka,ndegrees) Overfull \hbox (33.66461pt too wide) in paragraph at lines 2797--2798 []\TS1/cmtt/m/n/10 $\OT1/cmtt/m/n/10 obj->set[]EVD(mu,lambda,lowbound,highbound ,wonka,ndegrees) [60] [61] [62] Overfull \hbox (30.97293pt too wide) in paragraph at lines 2971--2972 []\OT1/cmr/m/n/10 should[]store Type [boolean (*should[]store)(int given[]score ,double in-ter-nal[]score[]level) [63] [64] [65] [66] [67] [68] [69] [70] [71] [72] [73] [74] [75] [76] Overfull \hbox (16.34366pt too wide) in paragraph at lines 3839--3840 []\OT1/cmtt/m/n/10 Wise2[]force[]to[]dna[]Sequence (seq,fraction,number[]of[]co nver) [77] [78] [79] [80] [81] [82] [83] [84] [85] [86] [87] Overfull \hbox (24.01358pt too wide) in paragraph at lines 4508--4515 \OT1/cmr/m/n/10 have any se-quence in it. When se-quence is asked for by get[]P rotein[]from[]Translation() [88] [89] Overfull \hbox (62.7533pt too wide) in paragraph at lines 4609--4610 []\OT1/cmtt/m/n/10 Wise2[]make[]align[]dnaalign (one,two,mat,se,qgap,qext,tgap, text,dpri) Overfull \hbox (40.0498pt too wide) in paragraph at lines 4610--4611 []\OT1/cmtt/m/n/10 &Wise2::make[]align[]dnaalign (one,two,mat,se,qgap,qext,tgap ,text,dpri) [90] Overfull \hbox (335.96082pt too wide) in paragraph at lines 4671--4672 []\OT1/cmtt/m/n/10 Wise2[]Hscore[]from[]TSM[]estwise (tdb,cdb,cp,cm,rmd,use[]sy n,alg,bits[]cutoff,allN,flat[]insert,report[]level,die[]on[]error,dbsi) Overfull \hbox (313.25732pt too wide) in paragraph at lines 4672--4673 []\OT1/cmtt/m/n/10 &Wise2::Hscore[]from[]TSM[]estwise (tdb,cdb,cp,cm,rmd,use[]s yn,alg,bits[]cutoff,allN,flat[]insert,report[]level,die[]on[]error,dbsi) [91] Overfull \hbox (329.87091pt too wide) in paragraph at lines 4698--4699 []\OT1/cmtt/m/n/10 Wise2[]AlnBlock[]from[]Protein[]estwise[]wrap (pro,cdna,cp,c m,ct,comp,gap,ext,is[]global,rmd,alg,rm,use[]syn,allN,dpri,palpoi) Overfull \hbox (270.41774pt too wide) in paragraph at lines 4699--4700 []\OT1/cmtt/m/n/10 &Wise2::AlnBlock[]from[]Protein[]estwise[]wrap (pro,cdna,cp, cm,ct,comp,gap,ext,is[]global,rmd,alg,rm,use[]syn,allN,dpri) [92] Overfull \hbox (265.40146pt too wide) in paragraph at lines 4732--4733 []\OT1/cmtt/m/n/10 Wise2[]AlnBlock[]from[]TSM[]estwise[]wrap (tsm,cdna,cp,cm,ct ,rmd,alg,use[]syn,force[]flat[]insert,allN,dpri,palpoi) Overfull \hbox (205.94829pt too wide) in paragraph at lines 4733--4734 []\OT1/cmtt/m/n/10 &Wise2::AlnBlock[]from[]TSM[]estwise[]wrap (tsm,cdna,cp,cm,c t,rmd,alg,use[]syn,force[]flat[]insert,allN,dpri) [93] Overfull \hbox (47.00343pt too wide) in paragraph at lines 4780--4781 []\OT1/cmtt/m/n/10 Wise2[]protein2genomic[]ascii[]display (alb,p,gen,ct,name,ma in,ofp) Overfull \hbox (24.29994pt too wide) in paragraph at lines 4781--4782 []\OT1/cmtt/m/n/10 &Wise2::protein2genomic[]ascii[]display (alb,p,gen,ct,name,m ain,ofp) [94] Overfull \hbox (188.7522pt too wide) in paragraph at lines 4801--4802 []\OT1/cmtt/m/n/10 Wise2[]protcdna[]ascii[]display (alb,protsequence,protname,p rotoff,cdna,ct,name,main,mult,ofp) Overfull \hbox (166.0487pt too wide) in paragraph at lines 4802--4803 []\OT1/cmtt/m/n/10 &Wise2::protcdna[]ascii[]display (alb,protsequence,protname, protoff,cdna,ct,name,main,mult,ofp) [95] Overfull \hbox (1.40793pt too wide) in paragraph at lines 4893--4894 []\OT1/cmr/m/n/10 transition[GENEFREQUENCY21[]TRANSITION[]LEN] Type [dou-ble : Scalar] [96] [97] Overfull \hbox (71.7832pt too wide) in paragraph at lines 5014--5015 []\OT1/cmtt/m/n/10 Wise2[]MatchSummarySet[]from[]AlnBlock[]estwise (alb,qname,o ffset,target) Overfull \hbox (1.83012pt too wide) in paragraph at lines 5015--5016 []\OT1/cmtt/m/n/10 &Wise2::MatchSummarySet::MatchSummarySet[]from[]AlnBlock[]es twise Overfull \hbox (62.22433pt too wide) in paragraph at lines 5017--5018 []\TS1/cmtt/m/n/10 $\OT1/cmtt/m/n/10 obj->MatchSummarySet[]from[]AlnBlock[]estw ise(qname,offset,target) [98] Overfull \hbox (82.28311pt too wide) in paragraph at lines 5040--5041 []\OT1/cmtt/m/n/10 Wise2[]MatchSummarySet[]from[]AlnBlock[]genewise (alb,qname, protoff,target) Overfull \hbox (7.08008pt too wide) in paragraph at lines 5041--5042 []\OT1/cmtt/m/n/10 &Wise2::MatchSummarySet::MatchSummarySet[]from[]AlnBlock[]ge newise Overfull \hbox (72.72424pt too wide) in paragraph at lines 5043--5044 []\TS1/cmtt/m/n/10 $\OT1/cmtt/m/n/10 obj->MatchSummarySet[]from[]AlnBlock[]gene wise(qname,protoff,target) [99] [100] Overfull \hbox (92.78302pt too wide) in paragraph at lines 5174--5175 []\OT1/cmtt/m/n/10 Wise2[]write[]pretty[]str[]align (alb,qname,query,tname,targ et,name,main,ofp) Overfull \hbox (70.07953pt too wide) in paragraph at lines 5175--5176 []\OT1/cmtt/m/n/10 &Wise2::write[]pretty[]str[]align (alb,qname,query,tname,tar get,name,main,ofp) [101] Overfull \hbox (3.5338pt too wide) in paragraph at lines 5217--5218 []\OT1/cmtt/m/n/10 Wise2[]write[]pretty[]Protein[]align (alb,q,t,name,main,ofp) [102] Overfull \hbox (29.5499pt too wide) in paragraph at lines 5290--5291 []\OT1/cmtt/m/n/10 &Wise2::DnaSequenceHitList::read[]MSPcrunch[]DnaSequenceHitL ist (ifp) [103] Overfull \hbox (99.50298pt too wide) in paragraph at lines 5348--5349 []\OT1/cmtt/m/n/10 Wise2[]Align[]strings[]ProteinSmithWaterman (one,two,comp,ga p,ext,dpenv,dpri) Overfull \hbox (76.79948pt too wide) in paragraph at lines 5349--5350 []\OT1/cmtt/m/n/10 &Wise2::Align[]strings[]ProteinSmithWaterman (one,two,comp,g ap,ext,dpenv,dpri) [104] Overfull \hbox (110.00288pt too wide) in paragraph at lines 5373--5374 []\OT1/cmtt/m/n/10 Wise2[]Align[]Sequences[]ProteinSmithWaterman (one,two,comp, gap,ext,dpenv,dpri) Overfull \hbox (87.2994pt too wide) in paragraph at lines 5374--5375 []\OT1/cmtt/m/n/10 &Wise2::Align[]Sequences[]ProteinSmithWaterman (one,two,comp ,gap,ext,dpenv,dpri) Overfull \hbox (7.58401pt too wide) in paragraph at lines 5386--5387 []\OT1/cmr/m/n/10 [OWNER] new AlnBlock struc-ture rep-re-sent-ing the align-men t [AlnBlock [105] Overfull \hbox (68.00325pt too wide) in paragraph at lines 5407--5408 []\OT1/cmtt/m/n/10 Wise2[]Align[]Proteins[]SmithWaterman (one,two,comp,gap,ext, dpenv,dpri) Overfull \hbox (45.29976pt too wide) in paragraph at lines 5408--5409 []\OT1/cmtt/m/n/10 &Wise2::Align[]Proteins[]SmithWaterman (one,two,comp,gap,ext ,dpenv,dpri) Overfull \hbox (5.0038pt too wide) in paragraph at lines 5434--5435 []\OT1/cmtt/m/n/10 Wise2[]Align[]Proteins[]ABC (one,two,comp,a,b,c,dpenv,dpri) [106] Overfull \hbox (47.00343pt too wide) in paragraph at lines 5455--5456 []\OT1/cmtt/m/n/10 Wise2[]Align[]Sequences[]ProteinABC (one,two,comp,a,b,c,dpen v,dpri) Overfull \hbox (24.29994pt too wide) in paragraph at lines 5456--5457 []\OT1/cmtt/m/n/10 &Wise2::Align[]Sequences[]ProteinABC (one,two,comp,a,b,c,dpe nv,dpri) Overfull \hbox (86.01088pt too wide) in paragraph at lines 5471--5474 \OT1/cmr/m/n/10 Align[]Sequences[]ProteinABC this func-tion is anal-o-gous to A lign[]Sequences[]ProteinSmithWaterman Overfull \hbox (240.62169pt too wide) in paragraph at lines 5478--5479 []\OT1/cmtt/m/n/10 Wise2[]Hscore[]from[]ProteinSW (querydb,targetdb,comp,gap,ex t,bits[]cutoff,report[]level,die[]on[]error,dbsi) Overfull \hbox (217.9182pt too wide) in paragraph at lines 5479--5480 []\OT1/cmtt/m/n/10 &Wise2::Hscore[]from[]ProteinSW (querydb,targetdb,comp,gap,e xt,bits[]cutoff,report[]level,die[]on[]error,dbsi) [107] Overfull \hbox (235.37173pt too wide) in paragraph at lines 5500--5501 []\OT1/cmtt/m/n/10 Wise2[]Hscore[]from[]ProteinABC (querydb,targetdb,comp,a,b,c ,bits[]cutoff,report[]level,die[]on[]error,dbsi) Overfull \hbox (212.66824pt too wide) in paragraph at lines 5501--5502 []\OT1/cmtt/m/n/10 &Wise2::Hscore[]from[]ProteinABC (querydb,targetdb,comp,a,b, c,bits[]cutoff,report[]level,die[]on[]error,dbsi) [108] Overfull \hbox (359.90063pt too wide) in paragraph at lines 5523--5524 []\OT1/cmtt/m/n/10 Wise2[]Hscore[]from[]ProteinBA (querydb,targetdb,comp,bentry ,bexit,bfor[]trans,b[]self[]trans,b3exit,bits[]cutoff,report[]level,dbsi) Overfull \hbox (337.19714pt too wide) in paragraph at lines 5524--5525 []\OT1/cmtt/m/n/10 &Wise2::Hscore[]from[]ProteinBA (querydb,targetdb,comp,bentr y,bexit,bfor[]trans,b[]self[]trans,b3exit,bits[]cutoff,report[]level,dbsi) [109] Overfull \hbox (15.42177pt too wide) in paragraph at lines 5587--5588 []\OT1/cmr/m/n/10 reload[]generic Type [Three-State-Model * (*reload[]generic)( ThreeStateDB * tdb,int Overfull \hbox (3.42192pt too wide) in paragraph at lines 5594--5595 []\OT1/cmr/m/n/10 dataentry[]add Type [boolean (*dataen-try[]add)(ThreeStateDB * tdb,DataEntry Overfull \hbox (41.78299pt too wide) in paragraph at lines 5598--5599 []\OT1/cmr/m/n/10 index[]generic Type [Three-State-Model * (*in-dex[]generic)(T hreeStateDB *tdb,DataEntry [110] Overfull \hbox (29.5499pt too wide) in paragraph at lines 5669--5670 []\OT1/cmtt/m/n/10 &Wise2::ThreeStateDB::new[]proteindb[]ThreeStateDB (sdb,comp ,gap,ext) [111] [112] [113] Overfull \hbox (16.10999pt too wide) in paragraph at lines 5802--5803 []\OT1/cmtt/m/n/10 &Wise2::ThreeStateModel::force[]global[]model (tsm,prob[]int o[]model) Overfull \hbox (102.65288pt too wide) in paragraph at lines 5822--5823 []\OT1/cmtt/m/n/10 Wise2[]force[]weighted[]local[]model (tsm,prob[]into[]model, ratio[]start,ratio[]end) Overfull \hbox (169.19861pt too wide) in paragraph at lines 5823--5824 []\OT1/cmtt/m/n/10 &Wise2::ThreeStateModel::force[]weighted[]local[]model (tsm, prob[]into[]model,ratio[]start,ratio[]end) Overfull \hbox (93.09401pt too wide) in paragraph at lines 5825--5826 []\TS1/cmtt/m/n/10 $\OT1/cmtt/m/n/10 obj->force[]weighted[]local[]model(prob[]i nto[]model,ratio[]start,ratio[]end) Overfull \hbox (49.31339pt too wide) in paragraph at lines 5845--5846 []\OT1/cmtt/m/n/10 Wise2[]ThreeStateModel[]from[]half[]bit[]Sequence (pro,mat,r m,gap,ext) [114] Overfull \hbox (5.61008pt too wide) in paragraph at lines 5846--5847 []\OT1/cmtt/m/n/10 &Wise2::ThreeStateModel::ThreeStateModel[]from[]half[]bit[]S equence Overfull \hbox (39.75452pt too wide) in paragraph at lines 5848--5849 []\TS1/cmtt/m/n/10 $\OT1/cmtt/m/n/10 obj->ThreeStateModel[]from[]half[]bit[]Seq uence(mat,rm,gap,ext) Overfull \hbox (51.38966pt too wide) in paragraph at lines 5872--5873 []\OT1/cmtt/m/n/10 &Wise2::ThreeStateModel::write[]HMMer[]1[]7[]ascii[]ThreeSta teModel (tsm,ofp) [115] [116] (./api.aux) LaTeX Warning: There were undefined references. LaTeX Warning: Label(s) may have changed. Rerun to get cross-references right. ) (see the transcript file for additional information) Output written on api.pdf (116 pages, 313009 bytes). Transcript written on api.log. cd docs && pdflatex dynamite.tex This is pdfTeX, Version 3.14159265-2.6-1.40.21 (TeX Live 2020/Debian) (preloaded format=pdflatex) restricted \write18 enabled. entering extended mode (./dynamite.tex LaTeX2e <2020-10-01> patch level 4 L3 programming layer <2021-01-09> xparse <2020-03-03> (/usr/share/texlive/texmf-dist/tex/latex/base/latex209.def Entering LaTeX 2.09 COMPATIBILITY MODE ************************************************************* !!WARNING!! !!WARNING!! !!WARNING!! !!WARNING!! This mode attempts to provide an emulation of the LaTeX 2.09 author environment so that OLD documents can be successfully processed. It should NOT be used for NEW documents! New documents should use Standard LaTeX conventions and start with the \documentclass command. Compatibility mode is UNLIKELY TO WORK with LaTeX 2.09 style files that change any internal macros, especially not with those that change the FONT SELECTION or OUTPUT ROUTINES. Therefore such style files MUST BE UPDATED to use Current Standard LaTeX: LaTeX2e. If you suspect that you may be using such a style file, which is probably very, very old by now, then you should attempt to get it updated by sending a copy of this error message to the author of that file. ************************************************************* (/usr/share/texlive/texmf-dist/tex/latex/base/tracefnt.sty) (/usr/share/texlive/texmf-dist/tex/latex/base/latexsym.sty)) (/usr/share/texlive/texmf-dist/tex/latex/base/article.cls Document Class: article 2020/04/10 v1.4m Standard LaTeX document class (/usr/share/texlive/texmf-dist/tex/latex/base/size10.clo)) (/usr/share/texlive/texmf-dist/tex/latex/l3backend/l3backend-pdftex.def) No file dynamite.aux. (/usr/share/texlive/texmf-dist/tex/latex/base/ulasy.fd) [1{/var/lib/texmf/fonts /map/pdftex/updmap/pdftex.map}] No file dynamite.toc. [2] [3] LaTeX Warning: Reference `own_objects' on page 4 undefined on input line 77. [4] [5] [6] Overfull \hbox (4.11092pt too wide) in paragraph at lines 253--257 \OT1/cmr/m/n/10 tri-bu-tion from 'ftp://ftp.sanger.ac.uk/pub/birney/dynamite/dy n.x.tar.Z' (where [7] [8] [9] [10] Overfull \hbox (48.74657pt too wide) in paragraph at lines 588--588 [] \OT1/cmtt/m/n/10 fprintf(ofp,"\npsw seq1 seq2\nBoth sequences in fasta format\n"[] Overfull \hbox (17.24684pt too wide) in paragraph at lines 588--588 [] \OT1/cmtt/m/n/10 * -g for gap value (an int) - rely on commandline error p rocessing[] Overfull \hbox (17.24684pt too wide) in paragraph at lines 588--588 [] \OT1/cmtt/m/n/10 * -e for ext value (an int) - rely on commandline error p rocessing[] [11] Overfull \hbox (269.24464pt too wide) in paragraph at lines 588--588 [] \OT1/cmtt/m/n/10 if( strip_out_boolean_argument(&argc,argv,"h") == TRUE || strip_out_boolean_argument(&argc,argv,"-help") == TRUE) {[] Overfull \hbox (43.49661pt too wide) in paragraph at lines 588--588 [] \OT1/cmtt/m/n/10 warn("Must have two arguments for sequence 1 and sequenc e 2 %d",argc);[] [12] Overfull \hbox (22.4968pt too wide) in paragraph at lines 588--588 [] \OT1/cmtt/m/n/10 * or WISEPERSONALDIR if it is not present in the current directory.[] Overfull \hbox (48.74657pt too wide) in paragraph at lines 588--588 [] \OT1/cmtt/m/n/10 fatal("Unable to make a protein complex sequence from %s ",query->name);[] Overfull \hbox (53.99652pt too wide) in paragraph at lines 588--588 [] \OT1/cmtt/m/n/10 fatal("Unable to make a protein complex sequence from %s ",target->name);[] Overfull \hbox (43.49661pt too wide) in paragraph at lines 588--588 [] \OT1/cmtt/m/n/10 * If the sequences are small enough then it should use ex plicit memory.[] [13] Overfull \hbox (59.24648pt too wide) in paragraph at lines 588--588 [] \OT1/cmtt/m/n/10 pal = PackAln_bestmemory_ProteinSW(query_cs,target_cs,comp ,-gap,-ext,NULL);[] Overfull \hbox (80.24629pt too wide) in paragraph at lines 588--588 [] \OT1/cmtt/m/n/10 fatal("Unable to make an alignment from %s and %s",query ->name,target->name);[] [14] Overfull \hbox (48.74657pt too wide) in paragraph at lines 632--632 [] \OT1/cmtt/m/n/10 fatal("Unable to make a protein complex sequence from %s ",query->name);[] Overfull \hbox (53.99652pt too wide) in paragraph at lines 632--632 [] \OT1/cmtt/m/n/10 fatal("Unable to make a protein complex sequence from %s ",target->name);[] Overfull \hbox (43.49661pt too wide) in paragraph at lines 632--632 [] \OT1/cmtt/m/n/10 * If the sequences are small enough then it should use ex plicit memory.[] Overfull \hbox (59.24648pt too wide) in paragraph at lines 632--632 [] \OT1/cmtt/m/n/10 pal = PackAln_bestmemory_ProteinSW(query_cs,target_cs,comp ,-gap,-ext,NULL);[] [15] Overfull \hbox (80.24629pt too wide) in paragraph at lines 632--632 [] \OT1/cmtt/m/n/10 fatal("Unable to make an alignment from %s and %s",query ->name,target->name);[] Overfull \hbox (32.9967pt too wide) in paragraph at lines 639--639 [] \OT1/cmtt/m/n/10 pal = PackAln_bestmemory_ProteinSW(query_cs,target_cs,comp ,-gap,-ext);[] Overfull \hbox (48.74657pt too wide) in paragraph at lines 654--654 [] \OT1/cmtt/m/n/10 fatal("Unable to make a protein complex sequence from %s ",query->name);[] [16] Overfull \hbox (22.4968pt too wide) in paragraph at lines 738--738 []\OT1/cmtt/m/n/10 Q22037 EPENLRKIFVGGLTSNTTDDLMREFYSQFGEITDIIVMR DPTTKRSRGF[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 738--738 [] \OT1/cmtt/m/n/10 EPE LRK+F+GGL+ TTD+ +R + Q+G +TD +VMR DP TKRSRGF[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 738--738 []\OT1/cmtt/m/n/10 ROA1_HUMAN EPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMR DPNTKRSRGF[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 738--738 []\OT1/cmtt/m/n/10 Q22037 GFVTFSGKTEVDAAMKQRPHIIDGKTVDPKRAVPRDDKN RSESNVSTKR[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 738--738 [] \OT1/cmtt/m/n/10 GFVT++ EVDAAM RPH +DG+ V+PKRAV R+D R ++++ K+[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 738--738 []\OT1/cmtt/m/n/10 ROA1_HUMAN GFVTYATVEEVDAAMNARPHKVDGRVVEPKRAVSREDSQ RPGAHLTVKK[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 738--738 []\OT1/cmtt/m/n/10 Q22037 LYVSGVREDHTEDMLTEYFTKYGTVTKSEIILDKATQKP RGFGFVTFDD[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 738--738 [] \OT1/cmtt/m/n/10 ++V G++ED E L +YF +YG + EI+ D+ + K RGF FVTFDD[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 738--738 []\OT1/cmtt/m/n/10 ROA1_HUMAN IFVGGIKEDTEEHHLRDYFEQYGKIEVIEIMTDRGSGKK RGFAFVTFDD[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 738--738 []\OT1/cmtt/m/n/10 Q22037 HDSVDQCVLQKSHMVNGHRCDVRKGLSKDEMSKAQMNRD RETRGGRSRD[] Overfull \hbox (11.99689pt too wide) in paragraph at lines 738--738 [] \OT1/cmtt/m/n/10 HDSVD+ V+QK H VNGH C+VRK LSK EM+ A ++ GRS[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 738--738 []\OT1/cmtt/m/n/10 ROA1_HUMAN HDSVDKIVIQKYHTVNGHNCEVRKALSKQEMASAS---- -SSQRGRSGS[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 738--738 []\OT1/cmtt/m/n/10 Q22037 GQRGGYNGGG-GGGGGWGGPAQRGGPGAYGGP-GGGGQG GYGGDYGG--[] Overfull \hbox (11.99689pt too wide) in paragraph at lines 738--738 [] \OT1/cmtt/m/n/10 G GG GGG GG +G G G +GG GGGG G G G Y G[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 738--738 []\OT1/cmtt/m/n/10 ROA1_HUMAN GNFGGGRGGGFGGNDNFGRGGNFSGRGGFGGSRGGGGYG GSGDGYNGFG[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 738--738 []\OT1/cmtt/m/n/10 Q22037 GWGQQGGGGQGGWGGPQQQQGGG-GWGQQGGGGQGGWGG PQQQQQGGWG[] Overfull \hbox (11.99689pt too wide) in paragraph at lines 738--738 [] \OT1/cmtt/m/n/10 G GGGG G GG + GG G+G QG G GG G GG[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 738--738 []\OT1/cmtt/m/n/10 ROA1_HUMAN NDGGYGGGGPGYSGGSRGYGSGGQGYGNQGSG-YGGSGS YDSYNNGGGR[] [17] [18] Overfull \hbox (48.88945pt too wide) in paragraph at lines 793--795 []\OT1/cmr/m/n/10 The align-ment is the set of (i,j,) triples, where sta te is one of (Match,Insert,Delete) [19] [20] Overfull \hbox (17.24684pt too wide) in paragraph at lines 942--942 [] \OT1/cmtt/m/n/10 calc="AAMATCH(comp,AMINOACID(query,i),AMINOACID(ta rget,j))"[] [21] Overfull \hbox (17.24684pt too wide) in paragraph at lines 942--942 [] \OT1/cmtt/m/n/10 calc="AAMATCH(comp,AMINOACID(query,i),AMINOACID(ta rget,j))"[] Overfull \hbox (17.24684pt too wide) in paragraph at lines 942--942 [] \OT1/cmtt/m/n/10 calc="AAMATCH(comp,AMINOACID(query,i),AMINOACID(ta rget,j))"[] Overfull \hbox (17.24684pt too wide) in paragraph at lines 942--942 [] \OT1/cmtt/m/n/10 calc="AAMATCH(comp,AMINOACID(query,i),AMINOACID(ta rget,j))"[] [22] Overfull \hbox (32.64503pt too wide) in paragraph at lines 1015--1019 \OT1/cmr/m/n/10 and GE-NOMIC[]INTRON. No-tice how the source lines to and from GE-NOMIC[]INSERT Overfull \hbox (38.24666pt too wide) in paragraph at lines 1116--1116 []\OT1/cmtt/m/n/10 #define DnaMatrix_Score(dnamat,base1,base2) (dnamat->score[b ase1][base2])[] [23] Overfull \hbox (11.99689pt too wide) in paragraph at lines 1116--1116 [] \OT1/cmtt/m/n/10 calc="DNA_MAT_SCORE(dm,CDNA_BASE(query,i),GENOMIC_BASE(tar get,j))"[] [24] [25] Overfull \hbox (122.24593pt too wide) in paragraph at lines 1335--1335 [] \OT1/cmtt/m/n/10 fprintf(ofp,"\nest2gen est-seq genomic-seq\nBoth sequences in fasta format\n"[] [26] Overfull \hbox (269.24464pt too wide) in paragraph at lines 1335--1335 [] \OT1/cmtt/m/n/10 if( strip_out_boolean_argument(&argc,argv,"h") == TRUE || strip_out_boolean_argument(&argc,argv,"-help") == TRUE) {[] [27] Overfull \hbox (43.49661pt too wide) in paragraph at lines 1335--1335 [] \OT1/cmtt/m/n/10 warn("Must have two arguments for sequence 1 and sequenc e 2 %d",argc);[] Overfull \hbox (27.74675pt too wide) in paragraph at lines 1335--1335 [] \OT1/cmtt/m/n/10 * To do this we need a cdna ComplexSequenceEvalSet and a genomic one[] Overfull \hbox (53.99652pt too wide) in paragraph at lines 1335--1335 [] \OT1/cmtt/m/n/10 * Really our genomic model should be alot more complex. T he 'default' one[] Overfull \hbox (38.24666pt too wide) in paragraph at lines 1335--1335 [] \OT1/cmtt/m/n/10 * has 0 at GT----AG for 5' and 3' splice sites, and NEGI (= -infinity)[] Overfull \hbox (27.74675pt too wide) in paragraph at lines 1335--1335 [] \OT1/cmtt/m/n/10 * We could build up something much better, using complexc onsensi and[] Overfull \hbox (43.49661pt too wide) in paragraph at lines 1335--1335 [] \OT1/cmtt/m/n/10 * other machinery, but not for now . See the genewi se code if you[] [28] Overfull \hbox (48.74657pt too wide) in paragraph at lines 1335--1335 [] \OT1/cmtt/m/n/10 fatal("Unable to make a protein complex sequence from %s ",query->name);[] Overfull \hbox (53.99652pt too wide) in paragraph at lines 1335--1335 [] \OT1/cmtt/m/n/10 fatal("Unable to make a protein complex sequence from %s ",target->name);[] Overfull \hbox (27.74675pt too wide) in paragraph at lines 1335--1335 [] \OT1/cmtt/m/n/10 * cDNA2Gen has alot more parameter space than the paramet ers to this[] Overfull \hbox (43.49661pt too wide) in paragraph at lines 1335--1335 [] \OT1/cmtt/m/n/10 * program. Firstly we are treating errors similarly on ea ch side of the[] Overfull \hbox (59.24648pt too wide) in paragraph at lines 1335--1335 [] \OT1/cmtt/m/n/10 * Secondly there is a rather complex interaction between the gap/extension[] Overfull \hbox (53.99652pt too wide) in paragraph at lines 1335--1335 [] \OT1/cmtt/m/n/10 * of what is thought to be sequencing error and the intro ns. Here we have[] Overfull \hbox (64.49643pt too wide) in paragraph at lines 1335--1335 [] \OT1/cmtt/m/n/10 * one more parameter, and intron open penalty, which can be set, to prevent[] Overfull \hbox (48.74657pt too wide) in paragraph at lines 1335--1335 [] \OT1/cmtt/m/n/10 * One good way to parameterise all this would be to have a probabilistic[] Overfull \hbox (48.74657pt too wide) in paragraph at lines 1335--1335 [] \OT1/cmtt/m/n/10 * model of the processes, derive probabilities and then m ap them to ints[] Overfull \hbox (27.74675pt too wide) in paragraph at lines 1335--1335 [] \OT1/cmtt/m/n/10 * (probability.h has got these mappings, such as Probabil ity2Score).[] Overfull \hbox (101.24611pt too wide) in paragraph at lines 1335--1335 [] \OT1/cmtt/m/n/10 pal = PackAln_bestmemory_cDNA2Gen(query_cs,target_cs,dm,ga p,-ext,-gap,-ext,0,NULL);[] Overfull \hbox (80.24629pt too wide) in paragraph at lines 1335--1335 [] \OT1/cmtt/m/n/10 fatal("Unable to make an alignment from %s and %s",query ->name,target->name);[] [29] Overfull \hbox (74.99634pt too wide) in paragraph at lines 1342--1342 [] \OT1/cmtt/m/n/10 pal = PackAln_bestmemory_cDNA2Gen(query_cs,target_cs,dm,ga p,-ext,-gap,-ext,0);[] [30] Overfull \hbox (27.74675pt too wide) in paragraph at lines 1379--1379 [] \OT1/cmtt/m/n/10 * To do this we need a cdna ComplexSequenceEvalSet and a genomic one[] Overfull \hbox (53.99652pt too wide) in paragraph at lines 1379--1379 [] \OT1/cmtt/m/n/10 * Really our genomic model should be alot more complex. T he 'default' one[] Overfull \hbox (38.24666pt too wide) in paragraph at lines 1379--1379 [] \OT1/cmtt/m/n/10 * has 0 at GT----AG for 5' and 3' splice sites, and NEGI (= -infinity)[] Overfull \hbox (27.74675pt too wide) in paragraph at lines 1379--1379 [] \OT1/cmtt/m/n/10 * We could build up something much better, using complexc onsensi and[] Overfull \hbox (43.49661pt too wide) in paragraph at lines 1379--1379 [] \OT1/cmtt/m/n/10 * other machinery, but not for now . See the genewi se code if you[] Overfull \hbox (48.74657pt too wide) in paragraph at lines 1379--1379 [] \OT1/cmtt/m/n/10 fatal("Unable to make a protein complex sequence from %s ",query->name);[] Overfull \hbox (53.99652pt too wide) in paragraph at lines 1379--1379 [] \OT1/cmtt/m/n/10 fatal("Unable to make a protein complex sequence from %s ",target->name);[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1465--1465 []\OT1/cmtt/m/n/10 HSHNCPA1 1 GGTGGCATTAAAGAAGACACTGAAGAACATCACCTAAGA GATGGT-TAT[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1465--1465 [] \OT1/cmtt/m/n/10 GGTGGCATTAAAGAAGACACTGAAGAACATCACCTAAGA GAT T T T[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1465--1465 []\OT1/cmtt/m/n/10 HSHNRNPA 2132 GGTGGCATTAAAGAAGACACTGAAGAACATCACCTAAGA GAT--TAT-T[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1465--1465 []\OT1/cmtt/m/n/10 HSHNCPA1 49 TTGAACAGTATGGAAAAATTGAAGTGATTGAAATCATGA CTGACCGAGG[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1465--1465 [] \OT1/cmtt/m/n/10 TTGAACAGTATGGAAAAATTGAAGTGATTGAAATCATGA CTGACCGAGG[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1465--1465 []\OT1/cmtt/m/n/10 HSHNRNPA 2178 TTGAACAGTATGGAAAAATTGAAGTGATTGAAATCATGA CTGACCGAGG[] [31] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1465--1465 []\OT1/cmtt/m/n/10 HSHNCPA1 98 CAGTGGCAAGAAAAGGGGCTTTGCCT-TAGTAACCTTTG ACGACCATGA[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1465--1465 [] \OT1/cmtt/m/n/10 CAGTGGCAAGAAAAGGGGCTTTGCCT T GTAACCTTTG ACGACCATGA[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1465--1465 []\OT1/cmtt/m/n/10 HSHNRNPA 2227 CAGTGGCAAGAAAAGGGGCTTTGCCTTT-GTAACCTTTG ACGACCATGA[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1465--1465 []\OT1/cmtt/m/n/10 HSHNCPA1 146 CTCCGTGGATAAGATTGTCA TTCAGA AATACCATAC[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1465--1465 [] \OT1/cmtt/m/n/10 CTCCGTGGATAAGATTGTCA TTCAGA AATACCATAC[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1465--1465 []\OT1/cmtt/m/n/10 HSHNRNPA 2275 CTCCGTGGATAAGATTGTCA<-2295:2387->TTCAGA AATACCATAC[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1465--1465 []\OT1/cmtt/m/n/10 HSHNCPA1 182 TGTGAATGGCCACAACTGTGAAGTTAGAAAAGCCCTGTC AAAGCAAGAG[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1465--1465 [] \OT1/cmtt/m/n/10 TGTGAATGGCCACAACTGTGAAGTTAGAAAAGCCCTGTC AAAGCAAGAG[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1465--1465 []\OT1/cmtt/m/n/10 HSHNRNPA 2404 TGTGAATGGCCACAACTGTGAAGTTAGAAAAGCCCTGTC AAAGCAAGAG[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1465--1465 []\OT1/cmtt/m/n/10 HSHNCPA1 231 ATGGCTAGTGCTTCATCCAGCCAAAGAG GTCGAAGT[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1465--1465 [] \OT1/cmtt/m/n/10 ATGGCTAGTGCTTCATCCAGCCAAAGAG GTCGAAGT[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1465--1465 []\OT1/cmtt/m/n/10 HSHNRNPA 2453 ATGGCTAGTGCTTCATCCAGCCAAAGAG<-2481:2566 ->GTCGAAGT[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1465--1465 []\OT1/cmtt/m/n/10 HSHNCPA1 267 GGTTCTGGAAACTTTGGTGGTGGTCGTGGAGGTGGTTTC GGTGGGAATG[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1465--1465 [] \OT1/cmtt/m/n/10 GGTTCTGGAAACTTTGGTGGTGGTCGTGGAGGTGGTTTC GGTGGGAATG[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1465--1465 []\OT1/cmtt/m/n/10 HSHNRNPA 2575 GGTTCTGGAAACTTTGGTGGTGGTCGTGGAGGTGGTTTC GGTGGGAATG[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1465--1465 []\OT1/cmtt/m/n/10 HSHNRNPA 2624 ACAACTTCGGTCGTGGAGGAAACTTCAGTGGTCGTG<-2 660:2793->[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1465--1465 []\OT1/cmtt/m/n/10 HSHNCPA1 352 GTNG-CTTTGGTGGCAGCCGTGGTGGTGGTGGATATGGT GGCAGTGGGG[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1465--1465 [] \OT1/cmtt/m/n/10 GT G CTTTGGTGGCAGCCGTGGTGGTGGTGGATATGGT GGCAGTGGGG[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1465--1465 []\OT1/cmtt/m/n/10 HSHNRNPA 2794 GT-GGCTTTGGTGGCAGCCGTGGTGGTGGTGGATATGGT GGCAGTGGGG[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1465--1465 []\OT1/cmtt/m/n/10 HSHNCPA1 400 ATGGCTATAATGGATTTGGCAATGATG GAAGCAATT[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1465--1465 [] \OT1/cmtt/m/n/10 ATGGCTATAATGGATTTGGCAATGATG GAAGCAATT[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1465--1465 []\OT1/cmtt/m/n/10 HSHNRNPA 2842 ATGGCTATAATGGATTTGGCAATGATG<-2869:3805- >GAAGCAATT[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1465--1465 []\OT1/cmtt/m/n/10 HSHNCPA1 436 TTGGAGGTGGTGGAAGCTACAATGATTTTGGG--tttat gcA-CAATCA[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1465--1465 [] \OT1/cmtt/m/n/10 TTGGAGGTGGTGGAAGCTACAATGATTTTGGG ++ + +A CAATCA[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1465--1465 []\OT1/cmtt/m/n/10 HSHNRNPA 3815 TTGGAGGTGGTGGAAGCTACAATGATTTTGGGAATT-A- -CAACAATCA[] [32] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1465--1465 []\OT1/cmtt/m/n/10 HSHNCPA1 482 GTCTTCAAATTTTGGACCCATGAAGGGAGGAAATTTTGG AGGCAGAAGC[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1465--1465 [] \OT1/cmtt/m/n/10 GTCTTCAAATTTTGGACCCATGAAGGGAGGAAATTTTGG AGGCAGAAGC[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1465--1465 []\OT1/cmtt/m/n/10 HSHNRNPA 3861 GTCTTCAAATTTTGGACCCATGAAGGGAGGAAATTTTGG AGGCAGAAGC[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1465--1465 []\OT1/cmtt/m/n/10 HSHNCPA1 531 TCTGGCCCCTATGGCGGTGGAGGCCAATACTTTGCAAAA CCACGAAACC[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1465--1465 [] \OT1/cmtt/m/n/10 TCTGGCCCCTATGGCGGTGGAGGCCAATACTTTGCAAAA CCACGAAACC[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1465--1465 []\OT1/cmtt/m/n/10 HSHNRNPA 3910 TCTGGCCCCTATGGCGGTGGAGGCCAATACTTTGCAAAA CCACGAAACC[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1465--1465 []\OT1/cmtt/m/n/10 HSHNCPA1 580 AAG GTGGCTATGGCGGTTCCAGCAGC AGCAGTAGCT[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1465--1465 [] \OT1/cmtt/m/n/10 AAG GTGGCTATGGCGGTTCCAGCAGC AGCAGTAGCT[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1465--1465 []\OT1/cmtt/m/n/10 HSHNRNPA 3959 AAG<-3962:4251->GTGGCTATGGCGGTTCCAGCAGC AGCAGTAGCT[] [33] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1572--1572 []\OT1/cmtt/m/n/10 query type="MySequence*" name="query" field:len="length_of _sequence"[] Overfull \hbox (27.74675pt too wide) in paragraph at lines 1572--1572 []\OT1/cmtt/m/n/10 target type="MySequence*" name="target" field:len="length_o f_sequence"[] [34] [35] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1600--1600 []\OT1/cmtt/m/n/10 query type="MySequence*" name="query" field:len="length_of _sequence"[] Overfull \hbox (17.24684pt too wide) in paragraph at lines 1634--1634 [] \OT1/cmtt/m/n/10 pal = PackAln_bestmemory_MyProteinSW(seqone,seqtwo,mat,-12, -2,NULL);[] Overfull \hbox (127.49588pt too wide) in paragraph at lines 1634--1634 [] \OT1/cmtt/m/n/10 fprintf(stdout,"%d,%d are matched with score %d\n",uni t->i+1,unit->j+1,unit->score);[] [36] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1727--1727 []\OT1/cmtt/m/n/10 query type="MySequence*" name="query" field:len="length_of _sequence"[] Overfull \hbox (27.74675pt too wide) in paragraph at lines 1727--1727 []\OT1/cmtt/m/n/10 target type="MySequence*" name="target" field:len="length_o f_sequence"[] [37] [38] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1849--1849 []\OT1/cmtt/m/n/10 query type="MySequence*" name="query" field:len="length_of _sequence"[] Overfull \hbox (27.74675pt too wide) in paragraph at lines 1849--1849 []\OT1/cmtt/m/n/10 target type="MySequence*" name="target" field:len="length_o f_sequence"[] [39] Overfull \hbox (258.74474pt too wide) in paragraph at lines 1849--1849 [] \OT1/cmtt/m/n/10 calc="ALPHA_SEQ_SCORE(query,i) + ALPHA_SEQ_SCORE(target,j) + mat_alpha.comp[SEQ_POS(query,i)][SEQ_POS(target,j)]"[] [40] [41] Overfull \hbox (20.54509pt too wide) in paragraph at lines 1911--1912 []\OT1/cmr/m/n/10 The macro Dna-Ma-trix[]Score which is de-fined at the top of the cdna2genomic.dy Overfull \hbox (17.24684pt too wide) in paragraph at lines 1928--1928 [] \OT1/cmtt/m/n/10 calc="DNA_MAT_SCORE(dm,CDNA_BASE(query,i),GENOMIC_CODON(ta rget,j))"[] [42] Overfull \hbox (53.99652pt too wide) in paragraph at lines 1944--1944 [] \OT1/cmtt/m/n/10 Mis-type in argument 3 of DNA\_MAT\_SCORE: wanted [b ase] got [codon][] Overfull \hbox (11.99689pt too wide) in paragraph at lines 1955--1955 [] \OT1/cmtt/m/n/10 calc="DNA_MAT_SCORE(dm,CDNA_BASE(query,j),GENOMIC_BASE(tar get,j))"[] Overfull \hbox (59.24648pt too wide) in paragraph at lines 1967--1967 [] \OT1/cmtt/m/n/10 For function CDNA\_BASE, you have arguments j and qu ery, which do not[] Overfull \hbox (11.99689pt too wide) in paragraph at lines 1967--1967 []\OT1/cmtt/m/n/10 expect to paired directly in a function. This is just a warn ing that[] [43] Overfull \hbox (17.24684pt too wide) in paragraph at lines 2014--2014 [] \OT1/cmtt/m/n/10 throw_warning("Letter %c does not exist in comparison matr ix",one);[] Overfull \hbox (17.24684pt too wide) in paragraph at lines 2014--2014 [] \OT1/cmtt/m/n/10 throw_warning("Letter %c does not exist in comparison matr ix",two);[] [44] [45] Overfull \hbox (74.99634pt too wide) in paragraph at lines 2255--2255 [] \OT1/cmtt/m/n/10 fprintf(stdout,"dbsearch [options] \n");[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 2255--2255 [] \OT1/cmtt/m/n/10 /** add more options here sometime, eg comp matrix and gap penalty*/[] Overfull \hbox (59.24648pt too wide) in paragraph at lines 2255--2255 [] \OT1/cmtt/m/n/10 /** print out dbsearch options. We don't know here what im plementations are[] Overfull \hbox (74.99634pt too wide) in paragraph at lines 2255--2255 [] \OT1/cmtt/m/n/10 either possible or how they are specified. Of course, there is the problem[] Overfull \hbox (59.24648pt too wide) in paragraph at lines 2255--2255 [] \OT1/cmtt/m/n/10 that we could clash our options with the dbsearchimpl options, but that[] Overfull \hbox (53.99652pt too wide) in paragraph at lines 2255--2255 [] \OT1/cmtt/m/n/10 is not too likely, and this makes this program future proof wrt to new[] [46] Overfull \hbox (43.49661pt too wide) in paragraph at lines 2255--2255 [] \OT1/cmtt/m/n/10 * care about which implementation is used, and does not k now either (!)[] [47] Overfull \hbox (106.49606pt too wide) in paragraph at lines 2255--2255 [] \OT1/cmtt/m/n/10 /* 10 means a score cutoff of 10, -1 means don't report on stderr search progress */[] Overfull \hbox (32.9967pt too wide) in paragraph at lines 2255--2255 [] \OT1/cmtt/m/n/10 if( search_ProteinSW(dbsi,out,querydb,prodb,mat,-12,-2) != SEARCH_OK )[] Overfull \hbox (53.99652pt too wide) in paragraph at lines 2255--2255 [] \OT1/cmtt/m/n/10 fatal("Some sort of error in the database search. Dieing ungracefully");[] Overfull \hbox (48.74657pt too wide) in paragraph at lines 2255--2255 [] \OT1/cmtt/m/n/10 fatal("Unable to make a protein complex sequence from %s ",query->name);[] Overfull \hbox (174.74547pt too wide) in paragraph at lines 2255--2255 [] \OT1/cmtt/m/n/10 fprintf(stdout,"Comparison to %s was %d score\n",out-> ds[i]->target->name,out->ds[i]->score);[] Overfull \hbox (1.49698pt too wide) in paragraph at lines 2255--2255 [] \OT1/cmtt/m/n/10 temp = get_Protein_from_ProteinDB(prodb,out->ds[i]->ta rget);[] [48] Overfull \hbox (69.74638pt too wide) in paragraph at lines 2255--2255 []\OT1/cmtt/m/n/10 fatal("Unable to make a protein complex sequence from %s",te mp->baseseq->name);[] Overfull \hbox (59.24648pt too wide) in paragraph at lines 2255--2255 [] \OT1/cmtt/m/n/10 pal = PackAln_bestmemory_ProteinSW(query_cs,target_cs, mat,-12,-2,NULL);[] Overfull \hbox (95.99615pt too wide) in paragraph at lines 2255--2255 []\OT1/cmtt/m/n/10 fatal("Unable to make an alignment from %s and %s",query->na me,temp->baseseq->name);[] Overfull \hbox (6.74693pt too wide) in paragraph at lines 2255--2255 [] \OT1/cmtt/m/n/10 write_pretty_seq_align(alb,query,temp->baseseq,15,50,s tdout);[] Overfull \hbox (32.9967pt too wide) in paragraph at lines 2263--2263 [] \OT1/cmtt/m/n/10 if( search_ProteinSW(dbsi,out,querydb,prodb,mat,-12,-2) != SEARCH_OK )[] Overfull \hbox (53.99652pt too wide) in paragraph at lines 2263--2263 [] \OT1/cmtt/m/n/10 fatal("Some sort of error in the database search. Dieing ungracefully");[] [49] Overfull \hbox (1.49698pt too wide) in paragraph at lines 2292--2292 [] \OT1/cmtt/m/n/10 temp = get_Protein_from_ProteinDB(prodb,out->ds[i]->ta rget);[] [50] [51] [52] [53] [54] Overfull \hbox (1.32472pt too wide) in paragraph at lines 2528--2534 \OT1/cmr/m/n/10 de-scribed by a "state...endstate" multi-line block. Within eac h "state...endstate" [55] [56] [57] [58] [59] Overfull \hbox (1.75064pt too wide) in paragraph at lines 2772--2776 \OT1/cmr/m/n/10 Dy-na-mite file: for ex-am-ple the fol-low-ing er-ror was made by mistyp-ing ``MATCH'' Overfull \hbox (59.24648pt too wide) in paragraph at lines 2792--2792 [] \OT1/cmtt/m/n/10 In matrix ProteinSW - State MATCH asks for source MA TCH2 but there is[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 2792--2792 [] \OT1/cmtt/m/n/10 Failing simple cross-checks, aborting before calc-li ne parsing[] [60] [61] [62] (./dynamite.aux) LaTeX Warning: There were undefined references. LaTeX Warning: Label(s) may have changed. Rerun to get cross-references right. ) (see the transcript file for additional information) Output written on dynamite.pdf (62 pages, 214458 bytes). Transcript written on dynamite.log. cd docs && pdflatex dynamite.tex This is pdfTeX, Version 3.14159265-2.6-1.40.21 (TeX Live 2020/Debian) (preloaded format=pdflatex) restricted \write18 enabled. entering extended mode (./dynamite.tex LaTeX2e <2020-10-01> patch level 4 L3 programming layer <2021-01-09> xparse <2020-03-03> (/usr/share/texlive/texmf-dist/tex/latex/base/latex209.def Entering LaTeX 2.09 COMPATIBILITY MODE ************************************************************* !!WARNING!! !!WARNING!! !!WARNING!! !!WARNING!! This mode attempts to provide an emulation of the LaTeX 2.09 author environment so that OLD documents can be successfully processed. It should NOT be used for NEW documents! New documents should use Standard LaTeX conventions and start with the \documentclass command. Compatibility mode is UNLIKELY TO WORK with LaTeX 2.09 style files that change any internal macros, especially not with those that change the FONT SELECTION or OUTPUT ROUTINES. Therefore such style files MUST BE UPDATED to use Current Standard LaTeX: LaTeX2e. If you suspect that you may be using such a style file, which is probably very, very old by now, then you should attempt to get it updated by sending a copy of this error message to the author of that file. ************************************************************* (/usr/share/texlive/texmf-dist/tex/latex/base/tracefnt.sty) (/usr/share/texlive/texmf-dist/tex/latex/base/latexsym.sty)) (/usr/share/texlive/texmf-dist/tex/latex/base/article.cls Document Class: article 2020/04/10 v1.4m Standard LaTeX document class (/usr/share/texlive/texmf-dist/tex/latex/base/size10.clo)) (/usr/share/texlive/texmf-dist/tex/latex/l3backend/l3backend-pdftex.def) (./dynamite.aux) (/usr/share/texlive/texmf-dist/tex/latex/base/ulasy.fd) [1{/var/lib/texmf/fonts/map/pdftex/updmap/pdftex.map}] (./dynamite.toc [2] Overfull \hbox (8.02837pt too wide) in paragraph at lines 50--50 [][] []\OT1/cmr/m/n/10 [Dynamite Level] Did not un-der-stand line [ source MAT CH]. ) [3] [4] [5] [6] [7] [8] Overfull \hbox (4.11092pt too wide) in paragraph at lines 253--257 \OT1/cmr/m/n/10 tri-bu-tion from 'ftp://ftp.sanger.ac.uk/pub/birney/dynamite/dy n.x.tar.Z' (where [9] [10] [11] [12] Overfull \hbox (48.74657pt too wide) in paragraph at lines 588--588 [] \OT1/cmtt/m/n/10 fprintf(ofp,"\npsw seq1 seq2\nBoth sequences in fasta format\n"[] Overfull \hbox (17.24684pt too wide) in paragraph at lines 588--588 [] \OT1/cmtt/m/n/10 * -g for gap value (an int) - rely on commandline error p rocessing[] Overfull \hbox (17.24684pt too wide) in paragraph at lines 588--588 [] \OT1/cmtt/m/n/10 * -e for ext value (an int) - rely on commandline error p rocessing[] [13] Overfull \hbox (269.24464pt too wide) in paragraph at lines 588--588 [] \OT1/cmtt/m/n/10 if( strip_out_boolean_argument(&argc,argv,"h") == TRUE || strip_out_boolean_argument(&argc,argv,"-help") == TRUE) {[] Overfull \hbox (43.49661pt too wide) in paragraph at lines 588--588 [] \OT1/cmtt/m/n/10 warn("Must have two arguments for sequence 1 and sequenc e 2 %d",argc);[] [14] Overfull \hbox (22.4968pt too wide) in paragraph at lines 588--588 [] \OT1/cmtt/m/n/10 * or WISEPERSONALDIR if it is not present in the current directory.[] Overfull \hbox (48.74657pt too wide) in paragraph at lines 588--588 [] \OT1/cmtt/m/n/10 fatal("Unable to make a protein complex sequence from %s ",query->name);[] Overfull \hbox (53.99652pt too wide) in paragraph at lines 588--588 [] \OT1/cmtt/m/n/10 fatal("Unable to make a protein complex sequence from %s ",target->name);[] Overfull \hbox (43.49661pt too wide) in paragraph at lines 588--588 [] \OT1/cmtt/m/n/10 * If the sequences are small enough then it should use ex plicit memory.[] [15] Overfull \hbox (59.24648pt too wide) in paragraph at lines 588--588 [] \OT1/cmtt/m/n/10 pal = PackAln_bestmemory_ProteinSW(query_cs,target_cs,comp ,-gap,-ext,NULL);[] Overfull \hbox (80.24629pt too wide) in paragraph at lines 588--588 [] \OT1/cmtt/m/n/10 fatal("Unable to make an alignment from %s and %s",query ->name,target->name);[] [16] Overfull \hbox (48.74657pt too wide) in paragraph at lines 632--632 [] \OT1/cmtt/m/n/10 fatal("Unable to make a protein complex sequence from %s ",query->name);[] Overfull \hbox (53.99652pt too wide) in paragraph at lines 632--632 [] \OT1/cmtt/m/n/10 fatal("Unable to make a protein complex sequence from %s ",target->name);[] Overfull \hbox (43.49661pt too wide) in paragraph at lines 632--632 [] \OT1/cmtt/m/n/10 * If the sequences are small enough then it should use ex plicit memory.[] Overfull \hbox (59.24648pt too wide) in paragraph at lines 632--632 [] \OT1/cmtt/m/n/10 pal = PackAln_bestmemory_ProteinSW(query_cs,target_cs,comp ,-gap,-ext,NULL);[] [17] Overfull \hbox (80.24629pt too wide) in paragraph at lines 632--632 [] \OT1/cmtt/m/n/10 fatal("Unable to make an alignment from %s and %s",query ->name,target->name);[] Overfull \hbox (32.9967pt too wide) in paragraph at lines 639--639 [] \OT1/cmtt/m/n/10 pal = PackAln_bestmemory_ProteinSW(query_cs,target_cs,comp ,-gap,-ext);[] Overfull \hbox (48.74657pt too wide) in paragraph at lines 654--654 [] \OT1/cmtt/m/n/10 fatal("Unable to make a protein complex sequence from %s ",query->name);[] [18] Overfull \hbox (22.4968pt too wide) in paragraph at lines 738--738 []\OT1/cmtt/m/n/10 Q22037 EPENLRKIFVGGLTSNTTDDLMREFYSQFGEITDIIVMR DPTTKRSRGF[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 738--738 [] \OT1/cmtt/m/n/10 EPE LRK+F+GGL+ TTD+ +R + Q+G +TD +VMR DP TKRSRGF[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 738--738 []\OT1/cmtt/m/n/10 ROA1_HUMAN EPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMR DPNTKRSRGF[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 738--738 []\OT1/cmtt/m/n/10 Q22037 GFVTFSGKTEVDAAMKQRPHIIDGKTVDPKRAVPRDDKN RSESNVSTKR[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 738--738 [] \OT1/cmtt/m/n/10 GFVT++ EVDAAM RPH +DG+ V+PKRAV R+D R ++++ K+[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 738--738 []\OT1/cmtt/m/n/10 ROA1_HUMAN GFVTYATVEEVDAAMNARPHKVDGRVVEPKRAVSREDSQ RPGAHLTVKK[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 738--738 []\OT1/cmtt/m/n/10 Q22037 LYVSGVREDHTEDMLTEYFTKYGTVTKSEIILDKATQKP RGFGFVTFDD[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 738--738 [] \OT1/cmtt/m/n/10 ++V G++ED E L +YF +YG + EI+ D+ + K RGF FVTFDD[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 738--738 []\OT1/cmtt/m/n/10 ROA1_HUMAN IFVGGIKEDTEEHHLRDYFEQYGKIEVIEIMTDRGSGKK RGFAFVTFDD[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 738--738 []\OT1/cmtt/m/n/10 Q22037 HDSVDQCVLQKSHMVNGHRCDVRKGLSKDEMSKAQMNRD RETRGGRSRD[] Overfull \hbox (11.99689pt too wide) in paragraph at lines 738--738 [] \OT1/cmtt/m/n/10 HDSVD+ V+QK H VNGH C+VRK LSK EM+ A ++ GRS[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 738--738 []\OT1/cmtt/m/n/10 ROA1_HUMAN HDSVDKIVIQKYHTVNGHNCEVRKALSKQEMASAS---- -SSQRGRSGS[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 738--738 []\OT1/cmtt/m/n/10 Q22037 GQRGGYNGGG-GGGGGWGGPAQRGGPGAYGGP-GGGGQG GYGGDYGG--[] Overfull \hbox (11.99689pt too wide) in paragraph at lines 738--738 [] \OT1/cmtt/m/n/10 G GG GGG GG +G G G +GG GGGG G G G Y G[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 738--738 []\OT1/cmtt/m/n/10 ROA1_HUMAN GNFGGGRGGGFGGNDNFGRGGNFSGRGGFGGSRGGGGYG GSGDGYNGFG[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 738--738 []\OT1/cmtt/m/n/10 Q22037 GWGQQGGGGQGGWGGPQQQQGGG-GWGQQGGGGQGGWGG PQQQQQGGWG[] Overfull \hbox (11.99689pt too wide) in paragraph at lines 738--738 [] \OT1/cmtt/m/n/10 G GGGG G GG + GG G+G QG G GG G GG[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 738--738 []\OT1/cmtt/m/n/10 ROA1_HUMAN NDGGYGGGGPGYSGGSRGYGSGGQGYGNQGSG-YGGSGS YDSYNNGGGR[] [19] [20] Overfull \hbox (48.88945pt too wide) in paragraph at lines 793--795 []\OT1/cmr/m/n/10 The align-ment is the set of (i,j,) triples, where sta te is one of (Match,Insert,Delete) [21] [22] Overfull \hbox (17.24684pt too wide) in paragraph at lines 942--942 [] \OT1/cmtt/m/n/10 calc="AAMATCH(comp,AMINOACID(query,i),AMINOACID(ta rget,j))"[] [23] Overfull \hbox (17.24684pt too wide) in paragraph at lines 942--942 [] \OT1/cmtt/m/n/10 calc="AAMATCH(comp,AMINOACID(query,i),AMINOACID(ta rget,j))"[] Overfull \hbox (17.24684pt too wide) in paragraph at lines 942--942 [] \OT1/cmtt/m/n/10 calc="AAMATCH(comp,AMINOACID(query,i),AMINOACID(ta rget,j))"[] Overfull \hbox (17.24684pt too wide) in paragraph at lines 942--942 [] \OT1/cmtt/m/n/10 calc="AAMATCH(comp,AMINOACID(query,i),AMINOACID(ta rget,j))"[] [24] Overfull \hbox (32.64503pt too wide) in paragraph at lines 1015--1019 \OT1/cmr/m/n/10 and GE-NOMIC[]INTRON. No-tice how the source lines to and from GE-NOMIC[]INSERT Overfull \hbox (38.24666pt too wide) in paragraph at lines 1116--1116 []\OT1/cmtt/m/n/10 #define DnaMatrix_Score(dnamat,base1,base2) (dnamat->score[b ase1][base2])[] [25] Overfull \hbox (11.99689pt too wide) in paragraph at lines 1116--1116 [] \OT1/cmtt/m/n/10 calc="DNA_MAT_SCORE(dm,CDNA_BASE(query,i),GENOMIC_BASE(tar get,j))"[] [26] [27] Overfull \hbox (122.24593pt too wide) in paragraph at lines 1335--1335 [] \OT1/cmtt/m/n/10 fprintf(ofp,"\nest2gen est-seq genomic-seq\nBoth sequences in fasta format\n"[] [28] Overfull \hbox (269.24464pt too wide) in paragraph at lines 1335--1335 [] \OT1/cmtt/m/n/10 if( strip_out_boolean_argument(&argc,argv,"h") == TRUE || strip_out_boolean_argument(&argc,argv,"-help") == TRUE) {[] [29] Overfull \hbox (43.49661pt too wide) in paragraph at lines 1335--1335 [] \OT1/cmtt/m/n/10 warn("Must have two arguments for sequence 1 and sequenc e 2 %d",argc);[] Overfull \hbox (27.74675pt too wide) in paragraph at lines 1335--1335 [] \OT1/cmtt/m/n/10 * To do this we need a cdna ComplexSequenceEvalSet and a genomic one[] Overfull \hbox (53.99652pt too wide) in paragraph at lines 1335--1335 [] \OT1/cmtt/m/n/10 * Really our genomic model should be alot more complex. T he 'default' one[] Overfull \hbox (38.24666pt too wide) in paragraph at lines 1335--1335 [] \OT1/cmtt/m/n/10 * has 0 at GT----AG for 5' and 3' splice sites, and NEGI (= -infinity)[] Overfull \hbox (27.74675pt too wide) in paragraph at lines 1335--1335 [] \OT1/cmtt/m/n/10 * We could build up something much better, using complexc onsensi and[] Overfull \hbox (43.49661pt too wide) in paragraph at lines 1335--1335 [] \OT1/cmtt/m/n/10 * other machinery, but not for now . See the genewi se code if you[] [30] Overfull \hbox (48.74657pt too wide) in paragraph at lines 1335--1335 [] \OT1/cmtt/m/n/10 fatal("Unable to make a protein complex sequence from %s ",query->name);[] Overfull \hbox (53.99652pt too wide) in paragraph at lines 1335--1335 [] \OT1/cmtt/m/n/10 fatal("Unable to make a protein complex sequence from %s ",target->name);[] Overfull \hbox (27.74675pt too wide) in paragraph at lines 1335--1335 [] \OT1/cmtt/m/n/10 * cDNA2Gen has alot more parameter space than the paramet ers to this[] Overfull \hbox (43.49661pt too wide) in paragraph at lines 1335--1335 [] \OT1/cmtt/m/n/10 * program. Firstly we are treating errors similarly on ea ch side of the[] Overfull \hbox (59.24648pt too wide) in paragraph at lines 1335--1335 [] \OT1/cmtt/m/n/10 * Secondly there is a rather complex interaction between the gap/extension[] Overfull \hbox (53.99652pt too wide) in paragraph at lines 1335--1335 [] \OT1/cmtt/m/n/10 * of what is thought to be sequencing error and the intro ns. Here we have[] Overfull \hbox (64.49643pt too wide) in paragraph at lines 1335--1335 [] \OT1/cmtt/m/n/10 * one more parameter, and intron open penalty, which can be set, to prevent[] Overfull \hbox (48.74657pt too wide) in paragraph at lines 1335--1335 [] \OT1/cmtt/m/n/10 * One good way to parameterise all this would be to have a probabilistic[] Overfull \hbox (48.74657pt too wide) in paragraph at lines 1335--1335 [] \OT1/cmtt/m/n/10 * model of the processes, derive probabilities and then m ap them to ints[] Overfull \hbox (27.74675pt too wide) in paragraph at lines 1335--1335 [] \OT1/cmtt/m/n/10 * (probability.h has got these mappings, such as Probabil ity2Score).[] Overfull \hbox (101.24611pt too wide) in paragraph at lines 1335--1335 [] \OT1/cmtt/m/n/10 pal = PackAln_bestmemory_cDNA2Gen(query_cs,target_cs,dm,ga p,-ext,-gap,-ext,0,NULL);[] Overfull \hbox (80.24629pt too wide) in paragraph at lines 1335--1335 [] \OT1/cmtt/m/n/10 fatal("Unable to make an alignment from %s and %s",query ->name,target->name);[] [31] Overfull \hbox (74.99634pt too wide) in paragraph at lines 1342--1342 [] \OT1/cmtt/m/n/10 pal = PackAln_bestmemory_cDNA2Gen(query_cs,target_cs,dm,ga p,-ext,-gap,-ext,0);[] [32] Overfull \hbox (27.74675pt too wide) in paragraph at lines 1379--1379 [] \OT1/cmtt/m/n/10 * To do this we need a cdna ComplexSequenceEvalSet and a genomic one[] Overfull \hbox (53.99652pt too wide) in paragraph at lines 1379--1379 [] \OT1/cmtt/m/n/10 * Really our genomic model should be alot more complex. T he 'default' one[] Overfull \hbox (38.24666pt too wide) in paragraph at lines 1379--1379 [] \OT1/cmtt/m/n/10 * has 0 at GT----AG for 5' and 3' splice sites, and NEGI (= -infinity)[] Overfull \hbox (27.74675pt too wide) in paragraph at lines 1379--1379 [] \OT1/cmtt/m/n/10 * We could build up something much better, using complexc onsensi and[] Overfull \hbox (43.49661pt too wide) in paragraph at lines 1379--1379 [] \OT1/cmtt/m/n/10 * other machinery, but not for now . See the genewi se code if you[] Overfull \hbox (48.74657pt too wide) in paragraph at lines 1379--1379 [] \OT1/cmtt/m/n/10 fatal("Unable to make a protein complex sequence from %s ",query->name);[] Overfull \hbox (53.99652pt too wide) in paragraph at lines 1379--1379 [] \OT1/cmtt/m/n/10 fatal("Unable to make a protein complex sequence from %s ",target->name);[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1465--1465 []\OT1/cmtt/m/n/10 HSHNCPA1 1 GGTGGCATTAAAGAAGACACTGAAGAACATCACCTAAGA GATGGT-TAT[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1465--1465 [] \OT1/cmtt/m/n/10 GGTGGCATTAAAGAAGACACTGAAGAACATCACCTAAGA GAT T T T[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1465--1465 []\OT1/cmtt/m/n/10 HSHNRNPA 2132 GGTGGCATTAAAGAAGACACTGAAGAACATCACCTAAGA GAT--TAT-T[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1465--1465 []\OT1/cmtt/m/n/10 HSHNCPA1 49 TTGAACAGTATGGAAAAATTGAAGTGATTGAAATCATGA CTGACCGAGG[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1465--1465 [] \OT1/cmtt/m/n/10 TTGAACAGTATGGAAAAATTGAAGTGATTGAAATCATGA CTGACCGAGG[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1465--1465 []\OT1/cmtt/m/n/10 HSHNRNPA 2178 TTGAACAGTATGGAAAAATTGAAGTGATTGAAATCATGA CTGACCGAGG[] [33] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1465--1465 []\OT1/cmtt/m/n/10 HSHNCPA1 98 CAGTGGCAAGAAAAGGGGCTTTGCCT-TAGTAACCTTTG ACGACCATGA[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1465--1465 [] \OT1/cmtt/m/n/10 CAGTGGCAAGAAAAGGGGCTTTGCCT T GTAACCTTTG ACGACCATGA[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1465--1465 []\OT1/cmtt/m/n/10 HSHNRNPA 2227 CAGTGGCAAGAAAAGGGGCTTTGCCTTT-GTAACCTTTG ACGACCATGA[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1465--1465 []\OT1/cmtt/m/n/10 HSHNCPA1 146 CTCCGTGGATAAGATTGTCA TTCAGA AATACCATAC[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1465--1465 [] \OT1/cmtt/m/n/10 CTCCGTGGATAAGATTGTCA TTCAGA AATACCATAC[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1465--1465 []\OT1/cmtt/m/n/10 HSHNRNPA 2275 CTCCGTGGATAAGATTGTCA<-2295:2387->TTCAGA AATACCATAC[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1465--1465 []\OT1/cmtt/m/n/10 HSHNCPA1 182 TGTGAATGGCCACAACTGTGAAGTTAGAAAAGCCCTGTC AAAGCAAGAG[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1465--1465 [] \OT1/cmtt/m/n/10 TGTGAATGGCCACAACTGTGAAGTTAGAAAAGCCCTGTC AAAGCAAGAG[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1465--1465 []\OT1/cmtt/m/n/10 HSHNRNPA 2404 TGTGAATGGCCACAACTGTGAAGTTAGAAAAGCCCTGTC AAAGCAAGAG[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1465--1465 []\OT1/cmtt/m/n/10 HSHNCPA1 231 ATGGCTAGTGCTTCATCCAGCCAAAGAG GTCGAAGT[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1465--1465 [] \OT1/cmtt/m/n/10 ATGGCTAGTGCTTCATCCAGCCAAAGAG GTCGAAGT[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1465--1465 []\OT1/cmtt/m/n/10 HSHNRNPA 2453 ATGGCTAGTGCTTCATCCAGCCAAAGAG<-2481:2566 ->GTCGAAGT[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1465--1465 []\OT1/cmtt/m/n/10 HSHNCPA1 267 GGTTCTGGAAACTTTGGTGGTGGTCGTGGAGGTGGTTTC GGTGGGAATG[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1465--1465 [] \OT1/cmtt/m/n/10 GGTTCTGGAAACTTTGGTGGTGGTCGTGGAGGTGGTTTC GGTGGGAATG[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1465--1465 []\OT1/cmtt/m/n/10 HSHNRNPA 2575 GGTTCTGGAAACTTTGGTGGTGGTCGTGGAGGTGGTTTC GGTGGGAATG[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1465--1465 []\OT1/cmtt/m/n/10 HSHNRNPA 2624 ACAACTTCGGTCGTGGAGGAAACTTCAGTGGTCGTG<-2 660:2793->[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1465--1465 []\OT1/cmtt/m/n/10 HSHNCPA1 352 GTNG-CTTTGGTGGCAGCCGTGGTGGTGGTGGATATGGT GGCAGTGGGG[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1465--1465 [] \OT1/cmtt/m/n/10 GT G CTTTGGTGGCAGCCGTGGTGGTGGTGGATATGGT GGCAGTGGGG[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1465--1465 []\OT1/cmtt/m/n/10 HSHNRNPA 2794 GT-GGCTTTGGTGGCAGCCGTGGTGGTGGTGGATATGGT GGCAGTGGGG[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1465--1465 []\OT1/cmtt/m/n/10 HSHNCPA1 400 ATGGCTATAATGGATTTGGCAATGATG GAAGCAATT[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1465--1465 [] \OT1/cmtt/m/n/10 ATGGCTATAATGGATTTGGCAATGATG GAAGCAATT[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1465--1465 []\OT1/cmtt/m/n/10 HSHNRNPA 2842 ATGGCTATAATGGATTTGGCAATGATG<-2869:3805- >GAAGCAATT[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1465--1465 []\OT1/cmtt/m/n/10 HSHNCPA1 436 TTGGAGGTGGTGGAAGCTACAATGATTTTGGG--tttat gcA-CAATCA[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1465--1465 [] \OT1/cmtt/m/n/10 TTGGAGGTGGTGGAAGCTACAATGATTTTGGG ++ + +A CAATCA[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1465--1465 []\OT1/cmtt/m/n/10 HSHNRNPA 3815 TTGGAGGTGGTGGAAGCTACAATGATTTTGGGAATT-A- -CAACAATCA[] [34] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1465--1465 []\OT1/cmtt/m/n/10 HSHNCPA1 482 GTCTTCAAATTTTGGACCCATGAAGGGAGGAAATTTTGG AGGCAGAAGC[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1465--1465 [] \OT1/cmtt/m/n/10 GTCTTCAAATTTTGGACCCATGAAGGGAGGAAATTTTGG AGGCAGAAGC[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1465--1465 []\OT1/cmtt/m/n/10 HSHNRNPA 3861 GTCTTCAAATTTTGGACCCATGAAGGGAGGAAATTTTGG AGGCAGAAGC[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1465--1465 []\OT1/cmtt/m/n/10 HSHNCPA1 531 TCTGGCCCCTATGGCGGTGGAGGCCAATACTTTGCAAAA CCACGAAACC[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1465--1465 [] \OT1/cmtt/m/n/10 TCTGGCCCCTATGGCGGTGGAGGCCAATACTTTGCAAAA CCACGAAACC[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1465--1465 []\OT1/cmtt/m/n/10 HSHNRNPA 3910 TCTGGCCCCTATGGCGGTGGAGGCCAATACTTTGCAAAA CCACGAAACC[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1465--1465 []\OT1/cmtt/m/n/10 HSHNCPA1 580 AAG GTGGCTATGGCGGTTCCAGCAGC AGCAGTAGCT[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1465--1465 [] \OT1/cmtt/m/n/10 AAG GTGGCTATGGCGGTTCCAGCAGC AGCAGTAGCT[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1465--1465 []\OT1/cmtt/m/n/10 HSHNRNPA 3959 AAG<-3962:4251->GTGGCTATGGCGGTTCCAGCAGC AGCAGTAGCT[] [35] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1572--1572 []\OT1/cmtt/m/n/10 query type="MySequence*" name="query" field:len="length_of _sequence"[] Overfull \hbox (27.74675pt too wide) in paragraph at lines 1572--1572 []\OT1/cmtt/m/n/10 target type="MySequence*" name="target" field:len="length_o f_sequence"[] [36] [37] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1600--1600 []\OT1/cmtt/m/n/10 query type="MySequence*" name="query" field:len="length_of _sequence"[] Overfull \hbox (17.24684pt too wide) in paragraph at lines 1634--1634 [] \OT1/cmtt/m/n/10 pal = PackAln_bestmemory_MyProteinSW(seqone,seqtwo,mat,-12, -2,NULL);[] Overfull \hbox (127.49588pt too wide) in paragraph at lines 1634--1634 [] \OT1/cmtt/m/n/10 fprintf(stdout,"%d,%d are matched with score %d\n",uni t->i+1,unit->j+1,unit->score);[] [38] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1727--1727 []\OT1/cmtt/m/n/10 query type="MySequence*" name="query" field:len="length_of _sequence"[] Overfull \hbox (27.74675pt too wide) in paragraph at lines 1727--1727 []\OT1/cmtt/m/n/10 target type="MySequence*" name="target" field:len="length_o f_sequence"[] [39] [40] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1849--1849 []\OT1/cmtt/m/n/10 query type="MySequence*" name="query" field:len="length_of _sequence"[] Overfull \hbox (27.74675pt too wide) in paragraph at lines 1849--1849 []\OT1/cmtt/m/n/10 target type="MySequence*" name="target" field:len="length_o f_sequence"[] [41] Overfull \hbox (258.74474pt too wide) in paragraph at lines 1849--1849 [] \OT1/cmtt/m/n/10 calc="ALPHA_SEQ_SCORE(query,i) + ALPHA_SEQ_SCORE(target,j) + mat_alpha.comp[SEQ_POS(query,i)][SEQ_POS(target,j)]"[] [42] [43] Overfull \hbox (20.54509pt too wide) in paragraph at lines 1911--1912 []\OT1/cmr/m/n/10 The macro Dna-Ma-trix[]Score which is de-fined at the top of the cdna2genomic.dy Overfull \hbox (17.24684pt too wide) in paragraph at lines 1928--1928 [] \OT1/cmtt/m/n/10 calc="DNA_MAT_SCORE(dm,CDNA_BASE(query,i),GENOMIC_CODON(ta rget,j))"[] [44] Overfull \hbox (53.99652pt too wide) in paragraph at lines 1944--1944 [] \OT1/cmtt/m/n/10 Mis-type in argument 3 of DNA\_MAT\_SCORE: wanted [b ase] got [codon][] Overfull \hbox (11.99689pt too wide) in paragraph at lines 1955--1955 [] \OT1/cmtt/m/n/10 calc="DNA_MAT_SCORE(dm,CDNA_BASE(query,j),GENOMIC_BASE(tar get,j))"[] Overfull \hbox (59.24648pt too wide) in paragraph at lines 1967--1967 [] \OT1/cmtt/m/n/10 For function CDNA\_BASE, you have arguments j and qu ery, which do not[] Overfull \hbox (11.99689pt too wide) in paragraph at lines 1967--1967 []\OT1/cmtt/m/n/10 expect to paired directly in a function. This is just a warn ing that[] [45] Overfull \hbox (17.24684pt too wide) in paragraph at lines 2014--2014 [] \OT1/cmtt/m/n/10 throw_warning("Letter %c does not exist in comparison matr ix",one);[] Overfull \hbox (17.24684pt too wide) in paragraph at lines 2014--2014 [] \OT1/cmtt/m/n/10 throw_warning("Letter %c does not exist in comparison matr ix",two);[] [46] [47] Overfull \hbox (74.99634pt too wide) in paragraph at lines 2255--2255 [] \OT1/cmtt/m/n/10 fprintf(stdout,"dbsearch [options] \n");[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 2255--2255 [] \OT1/cmtt/m/n/10 /** add more options here sometime, eg comp matrix and gap penalty*/[] Overfull \hbox (59.24648pt too wide) in paragraph at lines 2255--2255 [] \OT1/cmtt/m/n/10 /** print out dbsearch options. We don't know here what im plementations are[] Overfull \hbox (74.99634pt too wide) in paragraph at lines 2255--2255 [] \OT1/cmtt/m/n/10 either possible or how they are specified. Of course, there is the problem[] Overfull \hbox (59.24648pt too wide) in paragraph at lines 2255--2255 [] \OT1/cmtt/m/n/10 that we could clash our options with the dbsearchimpl options, but that[] Overfull \hbox (53.99652pt too wide) in paragraph at lines 2255--2255 [] \OT1/cmtt/m/n/10 is not too likely, and this makes this program future proof wrt to new[] [48] Overfull \hbox (43.49661pt too wide) in paragraph at lines 2255--2255 [] \OT1/cmtt/m/n/10 * care about which implementation is used, and does not k now either (!)[] [49] Overfull \hbox (106.49606pt too wide) in paragraph at lines 2255--2255 [] \OT1/cmtt/m/n/10 /* 10 means a score cutoff of 10, -1 means don't report on stderr search progress */[] Overfull \hbox (32.9967pt too wide) in paragraph at lines 2255--2255 [] \OT1/cmtt/m/n/10 if( search_ProteinSW(dbsi,out,querydb,prodb,mat,-12,-2) != SEARCH_OK )[] Overfull \hbox (53.99652pt too wide) in paragraph at lines 2255--2255 [] \OT1/cmtt/m/n/10 fatal("Some sort of error in the database search. Dieing ungracefully");[] Overfull \hbox (48.74657pt too wide) in paragraph at lines 2255--2255 [] \OT1/cmtt/m/n/10 fatal("Unable to make a protein complex sequence from %s ",query->name);[] Overfull \hbox (174.74547pt too wide) in paragraph at lines 2255--2255 [] \OT1/cmtt/m/n/10 fprintf(stdout,"Comparison to %s was %d score\n",out-> ds[i]->target->name,out->ds[i]->score);[] Overfull \hbox (1.49698pt too wide) in paragraph at lines 2255--2255 [] \OT1/cmtt/m/n/10 temp = get_Protein_from_ProteinDB(prodb,out->ds[i]->ta rget);[] [50] Overfull \hbox (69.74638pt too wide) in paragraph at lines 2255--2255 []\OT1/cmtt/m/n/10 fatal("Unable to make a protein complex sequence from %s",te mp->baseseq->name);[] Overfull \hbox (59.24648pt too wide) in paragraph at lines 2255--2255 [] \OT1/cmtt/m/n/10 pal = PackAln_bestmemory_ProteinSW(query_cs,target_cs, mat,-12,-2,NULL);[] Overfull \hbox (95.99615pt too wide) in paragraph at lines 2255--2255 []\OT1/cmtt/m/n/10 fatal("Unable to make an alignment from %s and %s",query->na me,temp->baseseq->name);[] Overfull \hbox (6.74693pt too wide) in paragraph at lines 2255--2255 [] \OT1/cmtt/m/n/10 write_pretty_seq_align(alb,query,temp->baseseq,15,50,s tdout);[] Overfull \hbox (32.9967pt too wide) in paragraph at lines 2263--2263 [] \OT1/cmtt/m/n/10 if( search_ProteinSW(dbsi,out,querydb,prodb,mat,-12,-2) != SEARCH_OK )[] Overfull \hbox (53.99652pt too wide) in paragraph at lines 2263--2263 [] \OT1/cmtt/m/n/10 fatal("Some sort of error in the database search. Dieing ungracefully");[] [51] Overfull \hbox (1.49698pt too wide) in paragraph at lines 2292--2292 [] \OT1/cmtt/m/n/10 temp = get_Protein_from_ProteinDB(prodb,out->ds[i]->ta rget);[] [52] [53] [54] [55] [56] Overfull \hbox (1.32472pt too wide) in paragraph at lines 2528--2534 \OT1/cmr/m/n/10 de-scribed by a "state...endstate" multi-line block. Within eac h "state...endstate" [57] [58] [59] [60] [61] Overfull \hbox (1.75064pt too wide) in paragraph at lines 2772--2776 \OT1/cmr/m/n/10 Dy-na-mite file: for ex-am-ple the fol-low-ing er-ror was made by mistyp-ing ``MATCH'' Overfull \hbox (59.24648pt too wide) in paragraph at lines 2792--2792 [] \OT1/cmtt/m/n/10 In matrix ProteinSW - State MATCH asks for source MA TCH2 but there is[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 2792--2792 [] \OT1/cmtt/m/n/10 Failing simple cross-checks, aborting before calc-li ne parsing[] [62] [63] [64] (./dynamite.aux) LaTeX Warning: Label(s) may have changed. Rerun to get cross-references right. ) (see the transcript file for additional information) Output written on dynamite.pdf (64 pages, 218023 bytes). Transcript written on dynamite.log. cd docs && pdflatex wise2.tex This is pdfTeX, Version 3.14159265-2.6-1.40.21 (TeX Live 2020/Debian) (preloaded format=pdflatex) restricted \write18 enabled. entering extended mode (./wise2.tex LaTeX2e <2020-10-01> patch level 4 L3 programming layer <2021-01-09> xparse <2020-03-03> (/usr/share/texlive/texmf-dist/tex/latex/base/article.cls Document Class: article 2020/04/10 v1.4m Standard LaTeX document class (/usr/share/texlive/texmf-dist/tex/latex/base/size10.clo)) (/usr/share/texlive/texmf-dist/tex/latex/graphics/graphicx.sty (/usr/share/texlive/texmf-dist/tex/latex/graphics/keyval.sty) (/usr/share/texlive/texmf-dist/tex/latex/graphics/graphics.sty (/usr/share/texlive/texmf-dist/tex/latex/graphics/trig.sty) (/usr/share/texlive/texmf-dist/tex/latex/graphics-cfg/graphics.cfg) (/usr/share/texlive/texmf-dist/tex/latex/graphics-def/pdftex.def))) (/usr/share/texlive/texmf-dist/tex/latex/l3backend/l3backend-pdftex.def) No file wise2.aux. (/usr/share/texlive/texmf-dist/tex/context/base/mkii/supp-pdf.mkii [Loading MPS to PDF converter (version 2006.09.02).] ) (/usr/share/texlive/texmf-dist/tex/latex/epstopdf-pkg/epstopdf-base.sty (/usr/share/texlive/texmf-dist/tex/latex/latexconfig/epstopdf-sys.cfg)) [1{/var/lib/texmf/fonts/map/pdftex/updmap/pdftex.map}] No file wise2.toc. [2] [3] [4] LaTeX Warning: Reference `genewise_large' on page 5 undefined on input line 110 . LaTeX Warning: Reference `estwise_large' on page 5 undefined on input line 113. Overfull \hbox (11.99689pt too wide) in paragraph at lines 206--206 []\OT1/cmtt/m/n/10 This program is freely distributed under a GPL. See source d irectory[] Overfull \hbox (48.74657pt too wide) in paragraph at lines 206--206 []\OT1/cmtt/m/n/10 Copyright (c) GRL limited: portions of the code are from sep arate copyright[] [5] Overfull \hbox (32.9967pt too wide) in paragraph at lines 206--206 []\OT1/cmtt/m/n/10 Warning: The bits scores is not probablistically correct for single seqs[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 206--206 []\OT1/cmtt/m/n/10 roa1_drome 88 AQKSRPHKIDGRVVEPKRAVPRQ DID[] Overfull \hbox (11.99689pt too wide) in paragraph at lines 206--206 [] \OT1/cmtt/m/n/10 A +RPHK+DGRVVEPKRAV R+ D[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 206--206 [] \OT1/cmtt/m/n/10 AMNARPHKVDGRVVEPKRAVSRE DSQ[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 206--206 []\OT1/cmtt/m/n/10 HSHNRNPA 1867 gaagaccagggagggcaaggtagGTGAGTG Intron 2 TAGgtc[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 206--206 [] \OT1/cmtt/m/n/10 ctacgcaataggttacagctcga<0-----[1936 : 2 083]-0>aca[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 206--206 [] \OT1/cmtt/m/n/10 tgtagacggtaatgaagatccaa tta[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 206--206 []\OT1/cmtt/m/n/10 roa1_drome 114 SPNAGATVKKLFVGALKDDHDEQSIRDYFQHFGNIVDIN IVIDKETGKK[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 206--206 [] \OT1/cmtt/m/n/10 P A TVKK+FVG +K+D +E +RDYF+ +G I I I+ D+ +GKK[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 206--206 [] \OT1/cmtt/m/n/10 RPGAHLTVKKIFVGGIKEDTEEHHLRDYFEQYGKIEVIE IMTDRGSGKK[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 206--206 []\OT1/cmtt/m/n/10 HSHNRNPA 2093 acggctagaaatgggaaggaggcccagttgctgaaggag aaagcgagaa[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 206--206 [] \OT1/cmtt/m/n/10 gcgcatctaatttggtaaacaaaatgaataaagatatta ttcaggggaa[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 206--206 [] \OT1/cmtt/m/n/10 aatccatgagatttctaactaatcaatttagtaatagta cgtcactcga[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 206--206 []\OT1/cmtt/m/n/10 roa1_drome 163 RGFAFVEFDDYDPVDKVV QKQHQ[] Overfull \hbox (17.24684pt too wide) in paragraph at lines 206--206 [] \OT1/cmtt/m/n/10 RGFAFV FDD+D VDK+V QK H[] [6] Overfull \hbox (22.4968pt too wide) in paragraph at lines 206--206 [] \OT1/cmtt/m/n/10 RGFAFVTFDDHDSVDKIV L:I[att] QKYHT[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 206--206 []\OT1/cmtt/m/n/10 HSHNRNPA 2240 agtgtgatggcgtggaagAGTAAGTA Intron 3 TAGTTcatca[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 206--206 [] \OT1/cmtt/m/n/10 ggtcttctaaaactaatt <1-----[2295 : 2387] -1> aaaac[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 206--206 [] \OT1/cmtt/m/n/10 gctctactcctccgtgtc gactt[] Overfull \hbox (6.74693pt too wide) in paragraph at lines 206--206 [] \OT1/cmtt/m/n/10 tagaagatgactcaaatcgcccgag <1-----[2481 : 2793][] [7] [8] LaTeX Warning: Reference `sec:start_end' on page 9 undefined on input line 297. [9] LaTeX Warning: Reference `half_and_blast' on page 10 undefined on input line 34 6. [10] [11] LaTeX Warning: Reference `genewise_large' on page 12 undefined on input line 45 5. LaTeX Warning: Reference `estwise_large' on page 12 undefined on input line 455 . LaTeX Warning: Reference `compile_pthread' on page 12 undefined on input line 4 66. LaTeX Warning: Reference `half_and_blast' on page 12 undefined on input line 47 3. [12] LaTeX Warning: Reference `half_and_blast' on page 13 undefined on input line 51 3. [13] [14] LaTeX Warning: Reference `running_pthread' on page 15 undefined on input line 6 13. [15] [16] [17] LaTeX Warning: Reference `Figure:genewise21' on page 18 undefined on input line 708. [18] [19] [20] LaTeX Warning: Reference `Figure:genewise623' on page 21 undefined on input lin e 900. [21] Overfull \hbox (2.03789pt too wide) in paragraph at lines 965--968 []\OT1/cmr/m/n/10 Algorithms are named in two parts, \OT1/cmr/m/it/10 descripti ve-word state-number:transition- [22] [23] [24] [25] Overfull \hbox (68.08423pt too wide) in paragraph at lines 1108--1109 []\OT1/cmr/m/n/10 The half-wise pro-tein database, found at ftp://ftp.sanger.ac .uk/pub/birney/wise2/halfwise [26] LaTeX Warning: Reference `sec:commonmode' on page 27 undefined on input line 11 81. [27] LaTeX Warning: Reference `sec:start_end' on page 28 undefined on input line 121 0. [28] Overfull \hbox (42.24687pt too wide) in paragraph at lines 1268--1268 []\OT1/cmtt/m/n/10 pexon [] Overfull \hbox (42.24687pt too wide) in paragraph at lines 1268--1268 []\OT1/cmtt/m/n/10 pexon [] [29] LaTeX Warning: Reference `sec:alg' on page 30 undefined on input line 1276. Overfull \hbox (36.99692pt too wide) in paragraph at lines 1312--1312 []\OT1/cmtt/m/n/10 Bits Query start end Target start end idel s introns[] Overfull \hbox (5.4972pt too wide) in paragraph at lines 1312--1312 []\OT1/cmtt/m/n/10 230.57 roa1_drome 26 347 HSHNRNPA 1386 3963 0 6[] [30] [31] LaTeX Warning: Reference `sec:start_end' on page 32 undefined on input line 137 7. [32] [33] [34] LaTeX Warning: Reference `sec:start_end' on page 35 undefined on input line 146 9. [35] [36] LaTeX Warning: Reference `compile_pthread' on page 37 undefined on input line 1 561. [37] [38] [39] [40] [41] [42] (./wise2.aux) LaTeX Warning: There were undefined references. LaTeX Warning: Label(s) may have changed. Rerun to get cross-references right. ) (see the transcript file for additional information) Output written on wise2.pdf (42 pages, 206333 bytes). Transcript written on wise2.log. cd docs && pdflatex wise2.tex This is pdfTeX, Version 3.14159265-2.6-1.40.21 (TeX Live 2020/Debian) (preloaded format=pdflatex) restricted \write18 enabled. entering extended mode (./wise2.tex LaTeX2e <2020-10-01> patch level 4 L3 programming layer <2021-01-09> xparse <2020-03-03> (/usr/share/texlive/texmf-dist/tex/latex/base/article.cls Document Class: article 2020/04/10 v1.4m Standard LaTeX document class (/usr/share/texlive/texmf-dist/tex/latex/base/size10.clo)) (/usr/share/texlive/texmf-dist/tex/latex/graphics/graphicx.sty (/usr/share/texlive/texmf-dist/tex/latex/graphics/keyval.sty) (/usr/share/texlive/texmf-dist/tex/latex/graphics/graphics.sty (/usr/share/texlive/texmf-dist/tex/latex/graphics/trig.sty) (/usr/share/texlive/texmf-dist/tex/latex/graphics-cfg/graphics.cfg) (/usr/share/texlive/texmf-dist/tex/latex/graphics-def/pdftex.def))) (/usr/share/texlive/texmf-dist/tex/latex/l3backend/l3backend-pdftex.def) (./wise2.aux) (/usr/share/texlive/texmf-dist/tex/context/base/mkii/supp-pdf.mkii [Loading MPS to PDF converter (version 2006.09.02).] ) (/usr/share/texlive/texmf-dist/tex/latex/epstopdf-pkg/epstopdf-base.sty (/usr/share/texlive/texmf-dist/tex/latex/latexconfig/epstopdf-sys.cfg)) [1{/var/lib/texmf/fonts/map/pdftex/updmap/pdftex.map}] (./wise2.toc [2]) [3] [4] [5] Overfull \hbox (11.99689pt too wide) in paragraph at lines 206--206 []\OT1/cmtt/m/n/10 This program is freely distributed under a GPL. See source d irectory[] Overfull \hbox (48.74657pt too wide) in paragraph at lines 206--206 []\OT1/cmtt/m/n/10 Copyright (c) GRL limited: portions of the code are from sep arate copyright[] [6] Overfull \hbox (32.9967pt too wide) in paragraph at lines 206--206 []\OT1/cmtt/m/n/10 Warning: The bits scores is not probablistically correct for single seqs[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 206--206 []\OT1/cmtt/m/n/10 roa1_drome 88 AQKSRPHKIDGRVVEPKRAVPRQ DID[] Overfull \hbox (11.99689pt too wide) in paragraph at lines 206--206 [] \OT1/cmtt/m/n/10 A +RPHK+DGRVVEPKRAV R+ D[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 206--206 [] \OT1/cmtt/m/n/10 AMNARPHKVDGRVVEPKRAVSRE DSQ[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 206--206 []\OT1/cmtt/m/n/10 HSHNRNPA 1867 gaagaccagggagggcaaggtagGTGAGTG Intron 2 TAGgtc[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 206--206 [] \OT1/cmtt/m/n/10 ctacgcaataggttacagctcga<0-----[1936 : 2 083]-0>aca[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 206--206 [] \OT1/cmtt/m/n/10 tgtagacggtaatgaagatccaa tta[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 206--206 []\OT1/cmtt/m/n/10 roa1_drome 114 SPNAGATVKKLFVGALKDDHDEQSIRDYFQHFGNIVDIN IVIDKETGKK[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 206--206 [] \OT1/cmtt/m/n/10 P A TVKK+FVG +K+D +E +RDYF+ +G I I I+ D+ +GKK[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 206--206 [] \OT1/cmtt/m/n/10 RPGAHLTVKKIFVGGIKEDTEEHHLRDYFEQYGKIEVIE IMTDRGSGKK[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 206--206 []\OT1/cmtt/m/n/10 HSHNRNPA 2093 acggctagaaatgggaaggaggcccagttgctgaaggag aaagcgagaa[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 206--206 [] \OT1/cmtt/m/n/10 gcgcatctaatttggtaaacaaaatgaataaagatatta ttcaggggaa[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 206--206 [] \OT1/cmtt/m/n/10 aatccatgagatttctaactaatcaatttagtaatagta cgtcactcga[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 206--206 []\OT1/cmtt/m/n/10 roa1_drome 163 RGFAFVEFDDYDPVDKVV QKQHQ[] Overfull \hbox (17.24684pt too wide) in paragraph at lines 206--206 [] \OT1/cmtt/m/n/10 RGFAFV FDD+D VDK+V QK H[] [7] Overfull \hbox (22.4968pt too wide) in paragraph at lines 206--206 [] \OT1/cmtt/m/n/10 RGFAFVTFDDHDSVDKIV L:I[att] QKYHT[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 206--206 []\OT1/cmtt/m/n/10 HSHNRNPA 2240 agtgtgatggcgtggaagAGTAAGTA Intron 3 TAGTTcatca[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 206--206 [] \OT1/cmtt/m/n/10 ggtcttctaaaactaatt <1-----[2295 : 2387] -1> aaaac[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 206--206 [] \OT1/cmtt/m/n/10 gctctactcctccgtgtc gactt[] Overfull \hbox (6.74693pt too wide) in paragraph at lines 206--206 [] \OT1/cmtt/m/n/10 tagaagatgactcaaatcgcccgag <1-----[2481 : 2793][] [8] [9] [10] [11] [12] [13] [14] [15] [16] [17] [18] LaTeX Warning: Reference `Figure:genewise21' on page 19 undefined on input line 708. [19] [20] [21] [22] Overfull \hbox (2.03789pt too wide) in paragraph at lines 965--968 []\OT1/cmr/m/n/10 Algorithms are named in two parts, \OT1/cmr/m/it/10 descripti ve-word state-number:transition- [23] [24] [25] [26] Overfull \hbox (68.08423pt too wide) in paragraph at lines 1108--1109 []\OT1/cmr/m/n/10 The half-wise pro-tein database, found at ftp://ftp.sanger.ac .uk/pub/birney/wise2/halfwise [27] [28] [29] Overfull \hbox (42.24687pt too wide) in paragraph at lines 1268--1268 []\OT1/cmtt/m/n/10 pexon [] Overfull \hbox (42.24687pt too wide) in paragraph at lines 1268--1268 []\OT1/cmtt/m/n/10 pexon [] [30] Overfull \hbox (36.99692pt too wide) in paragraph at lines 1312--1312 []\OT1/cmtt/m/n/10 Bits Query start end Target start end idel s introns[] Overfull \hbox (5.4972pt too wide) in paragraph at lines 1312--1312 []\OT1/cmtt/m/n/10 230.57 roa1_drome 26 347 HSHNRNPA 1386 3963 0 6[] [31] [32] [33] [34] [35] [36] [37] [38] [39] [40] [41] [42] [43] (./wise2.aux) LaTeX Warning: There were undefined references. LaTeX Warning: Label(s) may have changed. Rerun to get cross-references right. ) (see the transcript file for additional information) Output written on wise2.pdf (43 pages, 208648 bytes). Transcript written on wise2.log. cd docs && hevea api.tex ./api.tex:2: Warning: Command not found: \pdftrailerid ./api.tex:233: Warning: Undefined label: 'object_GeneFrequency' ./api.tex:236: Warning: Undefined label: 'module_gwrap' ./api.tex:237: Warning: Undefined label: 'module_gwrap' ./api.tex:238: Warning: Undefined label: 'module_gwrap' ./api.tex:239: Warning: Undefined label: 'module_gwrap' ./api.tex:389: Warning: Undefined label: 'module_gwrap' ./api.tex:426: Warning: Undefined label: 'module_codonmat' ./api.tex:435: Warning: Undefined label: 'module_dbimpl' ./api.tex:476: Warning: Application of '\'' on ',' failed ./api.tex:629: Warning: Application of '\'' on 't' failed ./api.tex:631: Warning: Application of '\'' on 'b' failed ./api.tex:633: Warning: Application of '\'' on 'b' failed ./api.tex:1642: Warning: Application of '\'' on 't' failed ./api.tex:1660: Warning: Application of '\'' on 't' failed ./api.tex:1882: Warning: Application of '\'' on '.' failed ./api.tex:2441: Warning: Application of '\'' on 'b' failed ./api.tex:2847: Warning: Application of '\'' on 'h' failed ./api.tex:2847: Warning: Application of '\'' on 't' failed ./api.tex:4435: Warning: Application of '\'' on '.' failed ./api.tex:4952: Warning: Application of '\'' on 'd' failed ./api.tex:4952: Warning: Application of '\'' on 'd' failed ./api.tex:5809: Warning: Application of '\'' on 'f' failed ./api.tex:5809: Warning: Application of '\'' on '[' failed ./api.tex:5830: Warning: Application of '\'' on 'f' failed ./api.tex:5830: Warning: Application of '\'' on '[' failed cd docs && hevea api.tex ./api.tex:2: Warning: Command not found: \pdftrailerid ./api.tex:233: Warning: Undefined label: 'object_GeneFrequency' ./api.tex:236: Warning: Undefined label: 'module_gwrap' ./api.tex:237: Warning: Undefined label: 'module_gwrap' ./api.tex:238: Warning: Undefined label: 'module_gwrap' ./api.tex:239: Warning: Undefined label: 'module_gwrap' ./api.tex:389: Warning: Undefined label: 'module_gwrap' ./api.tex:426: Warning: Undefined label: 'module_codonmat' ./api.tex:435: Warning: Undefined label: 'module_dbimpl' ./api.tex:476: Warning: Application of '\'' on ',' failed ./api.tex:629: Warning: Application of '\'' on 't' failed ./api.tex:631: Warning: Application of '\'' on 'b' failed ./api.tex:633: Warning: Application of '\'' on 'b' failed ./api.tex:1642: Warning: Application of '\'' on 't' failed ./api.tex:1660: Warning: Application of '\'' on 't' failed ./api.tex:1882: Warning: Application of '\'' on '.' failed ./api.tex:2441: Warning: Application of '\'' on 'b' failed ./api.tex:2847: Warning: Application of '\'' on 'h' failed ./api.tex:2847: Warning: Application of '\'' on 't' failed ./api.tex:4435: Warning: Application of '\'' on '.' failed ./api.tex:4952: Warning: Application of '\'' on 'd' failed ./api.tex:4952: Warning: Application of '\'' on 'd' failed ./api.tex:5809: Warning: Application of '\'' on 'f' failed ./api.tex:5809: Warning: Application of '\'' on '[' failed ./api.tex:5830: Warning: Application of '\'' on 'f' failed ./api.tex:5830: Warning: Application of '\'' on '[' failed cd docs && hevea dynamite.tex ./dynamite.tex:2: Warning: Command not found: \pdftrailerid ./dynamite.tex:2618: Warning: Command not found: \+ ./dynamite.tex:2618: Warning: Command not found: \* ./dynamite.tex:2619: Warning: Command not found: \* ./dynamite.tex:2756: Warning: Application of '\"' on ')' failed ./dynamite.tex:2756: Warning: Application of '\"' on ')' failed cd docs && hevea dynamite.tex ./dynamite.tex:2: Warning: Command not found: \pdftrailerid ./dynamite.tex:2618: Warning: Command not found: \+ ./dynamite.tex:2618: Warning: Command not found: \* ./dynamite.tex:2619: Warning: Command not found: \* ./dynamite.tex:2756: Warning: Application of '\"' on ')' failed ./dynamite.tex:2756: Warning: Application of '\"' on ')' failed cd docs && hevea wise2.tex ./wise2.tex:3: Warning: Command not found: \pdftrailerid ./wise2.tex:241: Warning: \hbox ./wise2.tex:243: Warning: \hbox ./wise2.tex:245: Warning: \hbox ./wise2.tex:247: Warning: \hbox ./wise2.tex:249: Warning: \hbox ./wise2.tex:251: Warning: \hbox ./wise2.tex:253: Warning: \hbox ./wise2.tex:255: Warning: \hbox ./wise2.tex:263: Warning: \hbox ./wise2.tex:265: Warning: \hbox ./wise2.tex:267: Warning: \hbox ./wise2.tex:269: Warning: \hbox ./wise2.tex:271: Warning: \hbox ./wise2.tex:273: Warning: \hbox ./wise2.tex:275: Warning: \hbox ./wise2.tex:277: Warning: \hbox ./wise2.tex:708: Warning: Undefined label: 'Figure:genewise21' ./wise2.tex:712: Warning: Command not found: \leavevmode ./wise2.tex:904: Warning: Command not found: \leavevmode cd docs && hevea wise2.tex ./wise2.tex:3: Warning: Command not found: \pdftrailerid ./wise2.tex:241: Warning: \hbox ./wise2.tex:243: Warning: \hbox ./wise2.tex:245: Warning: \hbox ./wise2.tex:247: Warning: \hbox ./wise2.tex:249: Warning: \hbox ./wise2.tex:251: Warning: \hbox ./wise2.tex:253: Warning: \hbox ./wise2.tex:255: Warning: \hbox ./wise2.tex:263: Warning: \hbox ./wise2.tex:265: Warning: \hbox ./wise2.tex:267: Warning: \hbox ./wise2.tex:269: Warning: \hbox ./wise2.tex:271: Warning: \hbox ./wise2.tex:273: Warning: \hbox ./wise2.tex:275: Warning: \hbox ./wise2.tex:277: Warning: \hbox ./wise2.tex:708: Warning: Undefined label: 'Figure:genewise21' ./wise2.tex:712: Warning: Command not found: \leavevmode ./wise2.tex:904: Warning: Command not found: \leavevmode mkdir -p docs/api mkdir -p docs/dynamite mkdir -p docs/wise2 mv docs/api.html docs/api mv docs/dynamite.html docs/dynamite mv docs/wise2.html docs/wise2 dh_auto_build make[1]: Leaving directory '/<>' create-stamp debian/debhelper-build-stamp dh_prep -a rm -f -- debian/wise.substvars rm -fr -- debian/.debhelper/generated/wise/ debian/wise/ debian/tmp/ dh_installdirs -a install -d debian/wise/usr/bin dh_install -a cp --reflink=auto -a ./src/bin/dba ./src/bin/dnal ./src/bin/estwise ./src/bin/estwisedb ./src/bin/genewise ./src/bin/genewisedb ./src/bin/promoterwise ./src/bin/psw ./src/bin/pswdb ./src/bin/scanwise ./src/bin/scanwise_server ./src/models/genomewise debian/wise/usr/bin/ install -d debian/.debhelper/generated/wise install -d debian/.debhelper/generated/wise-doc install -d debian/.debhelper/generated/wise-data dh_installdocs -a install -d debian/wise/usr/share/doc/wise cp --reflink=auto -a ./README debian/wise/usr/share/doc/wise cp --reflink=auto -a ./debian/tests/run-unit-test debian/wise/usr/share/doc/wise chmod -R u\+rw,go=rX debian/wise/usr/share/doc install -p -m0644 debian/README.Debian debian/wise/usr/share/doc/wise/README.Debian install -p -m0644 debian/copyright debian/wise/usr/share/doc/wise/copyright dh_installchangelogs -a install -p -m0644 debian/changelog debian/wise/usr/share/doc/wise/changelog.Debian dh_installexamples -a dh_installman -a install -d debian/wise/usr/share/man/man1/ install -p -m0644 ./debian/manpages.d/dba.1 debian/wise/usr/share/man/man1/dba.1 install -p -m0644 ./debian/manpages.d/dnal.1 debian/wise/usr/share/man/man1/dnal.1 install -p -m0644 ./debian/manpages.d/estwise.1 debian/wise/usr/share/man/man1/estwise.1 install -p -m0644 ./debian/manpages.d/estwisedb.1 debian/wise/usr/share/man/man1/estwisedb.1 install -p -m0644 ./debian/manpages.d/genewise.1 debian/wise/usr/share/man/man1/genewise.1 install -p -m0644 ./debian/manpages.d/genewisedb.1 debian/wise/usr/share/man/man1/genewisedb.1 install -p -m0644 ./debian/manpages.d/genomewise.1 debian/wise/usr/share/man/man1/genomewise.1 install -p -m0644 ./debian/manpages.d/promoterwise.1 debian/wise/usr/share/man/man1/promoterwise.1 install -p -m0644 ./debian/manpages.d/psw.1 debian/wise/usr/share/man/man1/psw.1 install -p -m0644 ./debian/manpages.d/pswdb.1 debian/wise/usr/share/man/man1/pswdb.1 install -p -m0644 ./debian/manpages.d/scanwise.1 debian/wise/usr/share/man/man1/scanwise.1 install -p -m0644 ./debian/manpages.d/scanwise_server.1 debian/wise/usr/share/man/man1/scanwise_server.1 man-recode --to-code UTF-8 --suffix .dh-new debian/wise/usr/share/man/man1/dba.1 debian/wise/usr/share/man/man1/dnal.1 debian/wise/usr/share/man/man1/estwise.1 debian/wise/usr/share/man/man1/estwisedb.1 debian/wise/usr/share/man/man1/genewise.1 debian/wise/usr/share/man/man1/genewisedb.1 debian/wise/usr/share/man/man1/genomewise.1 debian/wise/usr/share/man/man1/promoterwise.1 debian/wise/usr/share/man/man1/psw.1 debian/wise/usr/share/man/man1/pswdb.1 debian/wise/usr/share/man/man1/scanwise.1 debian/wise/usr/share/man/man1/scanwise_server.1 mv debian/wise/usr/share/man/man1/dba.1.dh-new debian/wise/usr/share/man/man1/dba.1 mv debian/wise/usr/share/man/man1/dnal.1.dh-new debian/wise/usr/share/man/man1/dnal.1 mv debian/wise/usr/share/man/man1/estwise.1.dh-new debian/wise/usr/share/man/man1/estwise.1 mv debian/wise/usr/share/man/man1/estwisedb.1.dh-new debian/wise/usr/share/man/man1/estwisedb.1 mv debian/wise/usr/share/man/man1/genewise.1.dh-new debian/wise/usr/share/man/man1/genewise.1 mv debian/wise/usr/share/man/man1/genewisedb.1.dh-new debian/wise/usr/share/man/man1/genewisedb.1 mv debian/wise/usr/share/man/man1/genomewise.1.dh-new debian/wise/usr/share/man/man1/genomewise.1 mv debian/wise/usr/share/man/man1/promoterwise.1.dh-new debian/wise/usr/share/man/man1/promoterwise.1 mv debian/wise/usr/share/man/man1/psw.1.dh-new debian/wise/usr/share/man/man1/psw.1 mv debian/wise/usr/share/man/man1/pswdb.1.dh-new debian/wise/usr/share/man/man1/pswdb.1 mv debian/wise/usr/share/man/man1/scanwise.1.dh-new debian/wise/usr/share/man/man1/scanwise.1 mv debian/wise/usr/share/man/man1/scanwise_server.1.dh-new debian/wise/usr/share/man/man1/scanwise_server.1 chmod 0644 -- debian/wise/usr/share/man/man1/dba.1 debian/wise/usr/share/man/man1/dnal.1 debian/wise/usr/share/man/man1/estwise.1 debian/wise/usr/share/man/man1/estwisedb.1 debian/wise/usr/share/man/man1/genewise.1 debian/wise/usr/share/man/man1/genewisedb.1 debian/wise/usr/share/man/man1/genomewise.1 debian/wise/usr/share/man/man1/promoterwise.1 debian/wise/usr/share/man/man1/psw.1 debian/wise/usr/share/man/man1/pswdb.1 debian/wise/usr/share/man/man1/scanwise.1 debian/wise/usr/share/man/man1/scanwise_server.1 dh_perl -a dh_link -a dh_strip_nondeterminism -a dh_compress -a cd debian/wise chmod a-x usr/share/doc/wise/changelog.Debian usr/share/man/man1/dba.1 usr/share/man/man1/dnal.1 usr/share/man/man1/estwise.1 usr/share/man/man1/estwisedb.1 usr/share/man/man1/genewise.1 usr/share/man/man1/genewisedb.1 usr/share/man/man1/genomewise.1 usr/share/man/man1/promoterwise.1 usr/share/man/man1/psw.1 usr/share/man/man1/pswdb.1 usr/share/man/man1/scanwise.1 usr/share/man/man1/scanwise_server.1 gzip -9nf usr/share/doc/wise/changelog.Debian usr/share/man/man1/dba.1 usr/share/man/man1/dnal.1 usr/share/man/man1/estwise.1 usr/share/man/man1/estwisedb.1 usr/share/man/man1/genewise.1 usr/share/man/man1/genewisedb.1 usr/share/man/man1/genomewise.1 usr/share/man/man1/promoterwise.1 usr/share/man/man1/psw.1 usr/share/man/man1/pswdb.1 usr/share/man/man1/scanwise.1 usr/share/man/man1/scanwise_server.1 cd '/<>' rm -f debian/wise.debhelper.log debian/rules override_dh_fixperms make[1]: Entering directory '/<>' dh_fixperms find debian/wise ! -type l -a -true -a -true -print0 2>/dev/null | xargs -0r chmod go=rX,u+rw,a-s find debian/wise/usr/share/doc -type f -a -true -a ! -regex 'debian/wise/usr/share/doc/[^/]*/examples/.*' -print0 2>/dev/null | xargs -0r chmod 0644 find debian/wise/usr/share/doc -type d -a -true -a -true -print0 2>/dev/null | xargs -0r chmod 0755 find debian/wise/usr/share/man -type f -a -true -a -true -print0 2>/dev/null | xargs -0r chmod 0644 find debian/wise -type f \( -name '*.so.*' -o -name '*.so' -o -name '*.la' -o -name '*.a' -o -name '*.js' -o -name '*.css' -o -name '*.scss' -o -name '*.sass' -o -name '*.jpeg' -o -name '*.jpg' -o -name '*.png' -o -name '*.gif' -o -name '*.cmxs' -o -name '*.node' \) -a -true -a -true -print0 2>/dev/null | xargs -0r chmod 0644 find debian/wise/usr/bin -type f -a -true -a -true -print0 2>/dev/null | xargs -0r chmod a+x find debian -iname "*.hmm" -exec chmod -x \{\} \; make[1]: Leaving directory '/<>' dh_missing -a dh_dwz -a install -d debian/wise/usr/lib/debug/.dwz/arm-linux-gnueabi dwz -mdebian/wise/usr/lib/debug/.dwz/arm-linux-gnueabi/wise.debug -M/usr/lib/debug/.dwz/arm-linux-gnueabi/wise.debug -- debian/wise/usr/bin/dba debian/wise/usr/bin/dnal debian/wise/usr/bin/estwise debian/wise/usr/bin/estwisedb debian/wise/usr/bin/genewise debian/wise/usr/bin/genewisedb debian/wise/usr/bin/genomewise debian/wise/usr/bin/promoterwise debian/wise/usr/bin/psw debian/wise/usr/bin/pswdb debian/wise/usr/bin/scanwise debian/wise/usr/bin/scanwise_server arm-linux-gnueabi-objcopy --compress-debug-sections debian/wise/usr/lib/debug/.dwz/arm-linux-gnueabi/wise.debug dh_strip -a install -d debian/.debhelper/wise/dbgsym-root/usr/lib/debug/.build-id/b6 arm-linux-gnueabi-objcopy --only-keep-debug --compress-debug-sections debian/wise/usr/bin/scanwise_server debian/.debhelper/wise/dbgsym-root/usr/lib/debug/.build-id/b6/405d6a0913f52d84e07f503818a4e660ec4348.debug chmod 0644 -- debian/.debhelper/wise/dbgsym-root/usr/lib/debug/.build-id/b6/405d6a0913f52d84e07f503818a4e660ec4348.debug arm-linux-gnueabi-strip --remove-section=.comment --remove-section=.note debian/wise/usr/bin/scanwise_server arm-linux-gnueabi-objcopy --add-gnu-debuglink debian/.debhelper/wise/dbgsym-root/usr/lib/debug/.build-id/b6/405d6a0913f52d84e07f503818a4e660ec4348.debug debian/wise/usr/bin/scanwise_server install -d debian/.debhelper/wise/dbgsym-root/usr/lib/debug/.build-id/71 arm-linux-gnueabi-objcopy --only-keep-debug --compress-debug-sections debian/wise/usr/bin/scanwise debian/.debhelper/wise/dbgsym-root/usr/lib/debug/.build-id/71/a4fce7d6bd0edd131049661536c4b6defda8bf.debug chmod 0644 -- debian/.debhelper/wise/dbgsym-root/usr/lib/debug/.build-id/71/a4fce7d6bd0edd131049661536c4b6defda8bf.debug arm-linux-gnueabi-strip --remove-section=.comment --remove-section=.note debian/wise/usr/bin/scanwise arm-linux-gnueabi-objcopy --add-gnu-debuglink debian/.debhelper/wise/dbgsym-root/usr/lib/debug/.build-id/71/a4fce7d6bd0edd131049661536c4b6defda8bf.debug debian/wise/usr/bin/scanwise install -d debian/.debhelper/wise/dbgsym-root/usr/lib/debug/.build-id/ea arm-linux-gnueabi-objcopy --only-keep-debug --compress-debug-sections debian/wise/usr/bin/pswdb debian/.debhelper/wise/dbgsym-root/usr/lib/debug/.build-id/ea/9b2415c55d6ac5db6b29e88c6146f554728cbb.debug chmod 0644 -- debian/.debhelper/wise/dbgsym-root/usr/lib/debug/.build-id/ea/9b2415c55d6ac5db6b29e88c6146f554728cbb.debug arm-linux-gnueabi-strip --remove-section=.comment --remove-section=.note debian/wise/usr/bin/pswdb arm-linux-gnueabi-objcopy --add-gnu-debuglink debian/.debhelper/wise/dbgsym-root/usr/lib/debug/.build-id/ea/9b2415c55d6ac5db6b29e88c6146f554728cbb.debug debian/wise/usr/bin/pswdb install -d debian/.debhelper/wise/dbgsym-root/usr/lib/debug/.build-id/18 arm-linux-gnueabi-objcopy --only-keep-debug --compress-debug-sections debian/wise/usr/bin/psw debian/.debhelper/wise/dbgsym-root/usr/lib/debug/.build-id/18/0902a34ebdc8bf24e16af277ada8700e7aae5b.debug chmod 0644 -- debian/.debhelper/wise/dbgsym-root/usr/lib/debug/.build-id/18/0902a34ebdc8bf24e16af277ada8700e7aae5b.debug arm-linux-gnueabi-strip --remove-section=.comment --remove-section=.note debian/wise/usr/bin/psw arm-linux-gnueabi-objcopy --add-gnu-debuglink debian/.debhelper/wise/dbgsym-root/usr/lib/debug/.build-id/18/0902a34ebdc8bf24e16af277ada8700e7aae5b.debug debian/wise/usr/bin/psw install -d debian/.debhelper/wise/dbgsym-root/usr/lib/debug/.build-id/38 arm-linux-gnueabi-objcopy --only-keep-debug --compress-debug-sections debian/wise/usr/bin/promoterwise debian/.debhelper/wise/dbgsym-root/usr/lib/debug/.build-id/38/1e787114a36010c97a9985d0b3493e918c501a.debug chmod 0644 -- debian/.debhelper/wise/dbgsym-root/usr/lib/debug/.build-id/38/1e787114a36010c97a9985d0b3493e918c501a.debug arm-linux-gnueabi-strip --remove-section=.comment --remove-section=.note debian/wise/usr/bin/promoterwise arm-linux-gnueabi-objcopy --add-gnu-debuglink debian/.debhelper/wise/dbgsym-root/usr/lib/debug/.build-id/38/1e787114a36010c97a9985d0b3493e918c501a.debug debian/wise/usr/bin/promoterwise install -d debian/.debhelper/wise/dbgsym-root/usr/lib/debug/.build-id/0d arm-linux-gnueabi-objcopy --only-keep-debug --compress-debug-sections debian/wise/usr/bin/genomewise debian/.debhelper/wise/dbgsym-root/usr/lib/debug/.build-id/0d/947bd535f93039baf3fa2fad2c1c3112049101.debug chmod 0644 -- debian/.debhelper/wise/dbgsym-root/usr/lib/debug/.build-id/0d/947bd535f93039baf3fa2fad2c1c3112049101.debug arm-linux-gnueabi-strip --remove-section=.comment --remove-section=.note debian/wise/usr/bin/genomewise arm-linux-gnueabi-objcopy --add-gnu-debuglink debian/.debhelper/wise/dbgsym-root/usr/lib/debug/.build-id/0d/947bd535f93039baf3fa2fad2c1c3112049101.debug debian/wise/usr/bin/genomewise install -d debian/.debhelper/wise/dbgsym-root/usr/lib/debug/.build-id/a1 arm-linux-gnueabi-objcopy --only-keep-debug --compress-debug-sections debian/wise/usr/bin/genewisedb debian/.debhelper/wise/dbgsym-root/usr/lib/debug/.build-id/a1/0841e57591892f9e591d0fd1d129b94f88452c.debug chmod 0644 -- debian/.debhelper/wise/dbgsym-root/usr/lib/debug/.build-id/a1/0841e57591892f9e591d0fd1d129b94f88452c.debug arm-linux-gnueabi-strip --remove-section=.comment --remove-section=.note debian/wise/usr/bin/genewisedb arm-linux-gnueabi-objcopy --add-gnu-debuglink debian/.debhelper/wise/dbgsym-root/usr/lib/debug/.build-id/a1/0841e57591892f9e591d0fd1d129b94f88452c.debug debian/wise/usr/bin/genewisedb install -d debian/.debhelper/wise/dbgsym-root/usr/lib/debug/.build-id/23 arm-linux-gnueabi-objcopy --only-keep-debug --compress-debug-sections debian/wise/usr/bin/genewise debian/.debhelper/wise/dbgsym-root/usr/lib/debug/.build-id/23/6929be280ce959e8f2159264b1ed966549bc54.debug chmod 0644 -- debian/.debhelper/wise/dbgsym-root/usr/lib/debug/.build-id/23/6929be280ce959e8f2159264b1ed966549bc54.debug arm-linux-gnueabi-strip --remove-section=.comment --remove-section=.note debian/wise/usr/bin/genewise arm-linux-gnueabi-objcopy --add-gnu-debuglink debian/.debhelper/wise/dbgsym-root/usr/lib/debug/.build-id/23/6929be280ce959e8f2159264b1ed966549bc54.debug debian/wise/usr/bin/genewise install -d debian/.debhelper/wise/dbgsym-root/usr/lib/debug/.build-id/1d arm-linux-gnueabi-objcopy --only-keep-debug --compress-debug-sections debian/wise/usr/bin/estwisedb debian/.debhelper/wise/dbgsym-root/usr/lib/debug/.build-id/1d/99617072a99ea67319ee6d664078c689d91b8e.debug chmod 0644 -- debian/.debhelper/wise/dbgsym-root/usr/lib/debug/.build-id/1d/99617072a99ea67319ee6d664078c689d91b8e.debug arm-linux-gnueabi-strip --remove-section=.comment --remove-section=.note debian/wise/usr/bin/estwisedb arm-linux-gnueabi-objcopy --add-gnu-debuglink debian/.debhelper/wise/dbgsym-root/usr/lib/debug/.build-id/1d/99617072a99ea67319ee6d664078c689d91b8e.debug debian/wise/usr/bin/estwisedb install -d debian/.debhelper/wise/dbgsym-root/usr/lib/debug/.build-id/93 arm-linux-gnueabi-objcopy --only-keep-debug --compress-debug-sections debian/wise/usr/bin/estwise debian/.debhelper/wise/dbgsym-root/usr/lib/debug/.build-id/93/a22bb64511af6675c17d041cb4fadf2986be9c.debug chmod 0644 -- debian/.debhelper/wise/dbgsym-root/usr/lib/debug/.build-id/93/a22bb64511af6675c17d041cb4fadf2986be9c.debug arm-linux-gnueabi-strip --remove-section=.comment --remove-section=.note debian/wise/usr/bin/estwise arm-linux-gnueabi-objcopy --add-gnu-debuglink debian/.debhelper/wise/dbgsym-root/usr/lib/debug/.build-id/93/a22bb64511af6675c17d041cb4fadf2986be9c.debug debian/wise/usr/bin/estwise install -d debian/.debhelper/wise/dbgsym-root/usr/lib/debug/.build-id/3a arm-linux-gnueabi-objcopy --only-keep-debug --compress-debug-sections debian/wise/usr/bin/dnal debian/.debhelper/wise/dbgsym-root/usr/lib/debug/.build-id/3a/6312024fa33078b728d331126408d0da95081f.debug chmod 0644 -- debian/.debhelper/wise/dbgsym-root/usr/lib/debug/.build-id/3a/6312024fa33078b728d331126408d0da95081f.debug arm-linux-gnueabi-strip --remove-section=.comment --remove-section=.note debian/wise/usr/bin/dnal arm-linux-gnueabi-objcopy --add-gnu-debuglink debian/.debhelper/wise/dbgsym-root/usr/lib/debug/.build-id/3a/6312024fa33078b728d331126408d0da95081f.debug debian/wise/usr/bin/dnal install -d debian/.debhelper/wise/dbgsym-root/usr/lib/debug/.build-id/bb arm-linux-gnueabi-objcopy --only-keep-debug --compress-debug-sections debian/wise/usr/bin/dba debian/.debhelper/wise/dbgsym-root/usr/lib/debug/.build-id/bb/19c8afcf37f2cb147d352f2b229b7505c307a9.debug chmod 0644 -- debian/.debhelper/wise/dbgsym-root/usr/lib/debug/.build-id/bb/19c8afcf37f2cb147d352f2b229b7505c307a9.debug arm-linux-gnueabi-strip --remove-section=.comment --remove-section=.note debian/wise/usr/bin/dba arm-linux-gnueabi-objcopy --add-gnu-debuglink debian/.debhelper/wise/dbgsym-root/usr/lib/debug/.build-id/bb/19c8afcf37f2cb147d352f2b229b7505c307a9.debug debian/wise/usr/bin/dba install -d debian/.debhelper/wise/dbgsym-root/usr/lib/debug/.dwz cp --reflink=auto -a debian/wise/usr/lib/debug/.dwz/arm-linux-gnueabi debian/.debhelper/wise/dbgsym-root/usr/lib/debug/.dwz rm -fr debian/wise/usr/lib/debug/.dwz rmdir -p --ignore-fail-on-non-empty debian/wise/usr/lib/debug install -d debian/.debhelper/wise/dbgsym-root/usr/share/doc ln -s wise debian/.debhelper/wise/dbgsym-root/usr/share/doc/wise-dbgsym dh_makeshlibs -a rm -f debian/wise/DEBIAN/shlibs dh_shlibdeps -a install -d debian/wise/DEBIAN dpkg-shlibdeps -Tdebian/wise.substvars debian/wise/usr/bin/dba debian/wise/usr/bin/dnal debian/wise/usr/bin/estwise debian/wise/usr/bin/estwisedb debian/wise/usr/bin/genewise debian/wise/usr/bin/genewisedb debian/wise/usr/bin/genomewise debian/wise/usr/bin/promoterwise debian/wise/usr/bin/psw debian/wise/usr/bin/pswdb debian/wise/usr/bin/scanwise debian/wise/usr/bin/scanwise_server dh_installdeb -a dh_gencontrol -a echo misc:Depends= >> debian/wise.substvars echo misc:Pre-Depends= >> debian/wise.substvars install -d debian/.debhelper/wise/dbgsym-root/DEBIAN dpkg-gencontrol -pwise -ldebian/changelog -Tdebian/wise.substvars -Pdebian/.debhelper/wise/dbgsym-root -UPre-Depends -URecommends -USuggests -UEnhances -UProvides -UEssential -UConflicts -DPriority=optional -UHomepage -UImportant -UBuilt-Using -DAuto-Built-Package=debug-symbols -UProtected -DPackage=wise-dbgsym "-DDepends=wise (= \${binary:Version})" "-DDescription=debug symbols for wise" "-DBuild-Ids=0d947bd535f93039baf3fa2fad2c1c3112049101 180902a34ebdc8bf24e16af277ada8700e7aae5b 1d99617072a99ea67319ee6d664078c689d91b8e 236929be280ce959e8f2159264b1ed966549bc54 381e787114a36010c97a9985d0b3493e918c501a 3a6312024fa33078b728d331126408d0da95081f 71a4fce7d6bd0edd131049661536c4b6defda8bf 93a22bb64511af6675c17d041cb4fadf2986be9c a10841e57591892f9e591d0fd1d129b94f88452c b6405d6a0913f52d84e07f503818a4e660ec4348 bb19c8afcf37f2cb147d352f2b229b7505c307a9 ea9b2415c55d6ac5db6b29e88c6146f554728cbb" -DSection=debug -UMulti-Arch -UReplaces -UBreaks chmod 0644 -- debian/.debhelper/wise/dbgsym-root/DEBIAN/control dpkg-gencontrol -pwise -ldebian/changelog -Tdebian/wise.substvars -Pdebian/wise chmod 0644 -- debian/wise/DEBIAN/control dh_md5sums -a cd debian/wise >/dev/null && xargs -r0 md5sum | perl -pe 'if (s@^\\@@) { s/\\\\/\\/g; }' > DEBIAN/md5sums chmod 0644 -- debian/wise/DEBIAN/md5sums cd debian/.debhelper/wise/dbgsym-root >/dev/null && xargs -r0 md5sum | perl -pe 'if (s@^\\@@) { s/\\\\/\\/g; }' > DEBIAN/md5sums chmod 0644 -- debian/.debhelper/wise/dbgsym-root/DEBIAN/md5sums dh_builddeb -a dpkg-deb --root-owner-group --build debian/wise .. dpkg-deb: building package 'wise' in '../wise_2.4.1-23_armel.deb'. dpkg-deb --root-owner-group --build debian/.debhelper/wise/dbgsym-root .. dpkg-deb: building package 'wise-dbgsym' in '../wise-dbgsym_2.4.1-23_armel.deb'. dpkg-genbuildinfo --build=any dpkg-genchanges --build=any >../wise_2.4.1-23_armel.changes dpkg-genchanges: info: binary-only arch-specific upload (source code and arch-indep packages not included) dpkg-source --after-build . dpkg-buildpackage: info: binary-only upload (no source included) -------------------------------------------------------------------------------- Build finished at 2021-06-05T17:30:25Z Finished -------- I: Built successfully +------------------------------------------------------------------------------+ | Changes | +------------------------------------------------------------------------------+ wise_2.4.1-23_armel.changes: ---------------------------- Format: 1.8 Date: Sat, 18 Apr 2020 17:57:01 +0200 Source: wise Binary: wise wise-dbgsym Built-For-Profiles: cross nocheck Architecture: armel Version: 2.4.1-23 Distribution: unstable Urgency: medium Maintainer: Debian Med Packaging Team Changed-By: Helmut Grohne Description: wise - comparison of biopolymers, like DNA and protein sequences Closes: 958094 Changes: wise (2.4.1-23) unstable; urgency=medium . * Team upload. * Do not hard code the build architecture pkg-config Closes: #958094 Checksums-Sha1: dd24da5cae87c1ba31ad2caf6fc77686b32d507b 7434776 wise-dbgsym_2.4.1-23_armel.deb e42da534c2685b74e4db30d0967f249e0c781878 8664 wise_2.4.1-23_armel.buildinfo f8f81742025310d1e224dad94648553ddfdbb2c6 761528 wise_2.4.1-23_armel.deb Checksums-Sha256: 0c73daa4e8827aa8c02ca2d3cd32de07faf9a9bfaafab05809c680c20cda2a87 7434776 wise-dbgsym_2.4.1-23_armel.deb 7adf66af93e8ceed5e93c3b36201464dcc77215067a862612aac5c56ede8979d 8664 wise_2.4.1-23_armel.buildinfo 2fc0e485b091c4f34611e616506751f44b72e8e33e1b88cad604a70191e450a3 761528 wise_2.4.1-23_armel.deb Files: a1e46dbf8dd2e571b0cf71e5685869bf 7434776 debug optional wise-dbgsym_2.4.1-23_armel.deb a4df69a11024af6ed9c4d618c04ee83f 8664 science optional wise_2.4.1-23_armel.buildinfo 7bf69fd153f094d0690f4c97f4002b21 761528 science optional wise_2.4.1-23_armel.deb +------------------------------------------------------------------------------+ | Buildinfo | +------------------------------------------------------------------------------+ Format: 1.0 Source: wise Binary: wise wise-dbgsym Architecture: armel Version: 2.4.1-23 Checksums-Md5: a1e46dbf8dd2e571b0cf71e5685869bf 7434776 wise-dbgsym_2.4.1-23_armel.deb 7bf69fd153f094d0690f4c97f4002b21 761528 wise_2.4.1-23_armel.deb Checksums-Sha1: dd24da5cae87c1ba31ad2caf6fc77686b32d507b 7434776 wise-dbgsym_2.4.1-23_armel.deb f8f81742025310d1e224dad94648553ddfdbb2c6 761528 wise_2.4.1-23_armel.deb Checksums-Sha256: 0c73daa4e8827aa8c02ca2d3cd32de07faf9a9bfaafab05809c680c20cda2a87 7434776 wise-dbgsym_2.4.1-23_armel.deb 2fc0e485b091c4f34611e616506751f44b72e8e33e1b88cad604a70191e450a3 761528 wise_2.4.1-23_armel.deb Build-Origin: Debian Build-Architecture: amd64 Build-Date: Sat, 05 Jun 2021 17:30:25 +0000 Build-Path: /<> Installed-Build-Depends: autoconf (= 2.69-14), automake (= 1:1.16.3-2), autopoint (= 0.21-4), autotools-dev (= 20180224.1+nmu1), base-files (= 11.1), base-passwd (= 3.5.50), bash (= 5.1-3), binutils (= 2.35.2-2), binutils-common (= 2.35.2-2), binutils-x86-64-linux-gnu (= 2.35.2-2), bsdextrautils (= 2.36.1-7), bsdutils (= 1:2.36.1-7), build-essential (= 12.9), bzip2 (= 1.0.8-4), coreutils (= 8.32-4+b1), cpp (= 4:10.2.1-1), cpp-10 (= 10.2.1-6), dash (= 0.5.11+git20210120+802ebd4-1), debconf (= 1.5.76), debhelper (= 13.3.4), debianutils (= 4.11.2), dh-autoreconf (= 20), dh-strip-nondeterminism (= 1.12.0-1), diffutils (= 1:3.7-5), docbook (= 4.5-6), docbook-to-man (= 1:2.0.0-45), dpkg (= 1.20.9), dpkg-dev (= 1.20.9), dwz (= 0.14-1), file (= 1:5.39-3), findutils (= 4.8.0-1), fontconfig-config (= 2.13.1-4.2), fonts-dejavu-core (= 2.37-2), fonts-lmodern (= 2.004.5-6.1), fonts-urw-base35 (= 20200910-1), g++ (= 4:10.2.1-1), g++-10 (= 10.2.1-6), gcc (= 4:10.2.1-1), gcc-10 (= 10.2.1-6), gcc-10-base (= 10.2.1-6), gettext (= 0.21-4), gettext-base (= 0.21-4), ghostscript (= 9.53.3~dfsg-7), grep (= 3.6-1), groff-base (= 1.22.4-6), gzip (= 1.10-4), hevea (= 2.34-2+b1), hostname (= 3.23), init-system-helpers (= 1.60), intltool-debian (= 0.35.0+20060710.5), libacl1 (= 2.2.53-10), libarchive-zip-perl (= 1.68-1), libasan6 (= 10.2.1-6), libatomic1 (= 10.2.1-6), libattr1 (= 1:2.4.48-6), libaudit-common (= 1:3.0-2), libaudit1 (= 1:3.0-2), libavahi-client3 (= 0.8-5), libavahi-common-data (= 0.8-5), libavahi-common3 (= 0.8-5), libbinutils (= 2.35.2-2), libblkid-dev (= 2.36.1-7), libblkid1 (= 2.36.1-7), libbrotli1 (= 1.0.9-2+b2), libbsd0 (= 0.11.3-1), libbz2-1.0 (= 1.0.8-4), libc-bin (= 2.31-12), libc-dev-bin (= 2.31-12), libc6 (= 2.31-12), libc6-dev (= 2.31-12), libcairo2 (= 1.16.0-5), libcap-ng0 (= 0.7.9-2.2+b1), libcc1-0 (= 10.2.1-6), libcom-err2 (= 1.46.2-1), libcrypt-dev (= 1:4.4.18-4), libcrypt1 (= 1:4.4.18-4), libctf-nobfd0 (= 2.35.2-2), libctf0 (= 2.35.2-2), libcups2 (= 2.3.3op2-3+deb11u1), libdatrie1 (= 0.2.13-1), libdb5.3 (= 5.3.28+dfsg1-0.8), libdbus-1-3 (= 1.12.20-2), libdebconfclient0 (= 0.259), libdebhelper-perl (= 13.3.4), libdeflate0 (= 1.7-1), libdpkg-perl (= 1.20.9), libelf1 (= 0.183-3), libexpat1 (= 2.2.10-2), libffi-dev (= 3.3-6), libffi7 (= 3.3-6), libfile-stripnondeterminism-perl (= 1.12.0-1), libfontconfig1 (= 2.13.1-4.2), libfontenc1 (= 1:1.1.4-1), libfreetype6 (= 2.10.4+dfsg-1), libgcc-10-dev (= 10.2.1-6), libgcc-s1 (= 10.2.1-6), libgcrypt20 (= 1.8.7-6), libgdbm-compat4 (= 1.19-2), libgdbm6 (= 1.19-2), libglib2.0-0 (= 2.66.8-1), libglib2.0-bin (= 2.66.8-1), libglib2.0-data (= 2.66.8-1), libglib2.0-dev (= 2.66.8-1), libglib2.0-dev-bin (= 2.66.8-1), libgmp10 (= 2:6.2.1+dfsg-1), libgnutls30 (= 3.7.1-5), libgomp1 (= 10.2.1-6), libgpg-error0 (= 1.38-2), libgraphite2-3 (= 1.3.14-1), libgs9 (= 9.53.3~dfsg-7), libgs9-common (= 9.53.3~dfsg-7), libgssapi-krb5-2 (= 1.18.3-5), libharfbuzz0b (= 2.7.4-1), libhogweed6 (= 3.7.2-3), libice6 (= 2:1.0.10-1), libicu67 (= 67.1-6), libidn11 (= 1.33-3), libidn2-0 (= 2.3.0-5), libijs-0.35 (= 0.35-15), libisl23 (= 0.23-1), libitm1 (= 10.2.1-6), libjbig0 (= 2.1-3.1+b2), libjbig2dec0 (= 0.19-3), libjpeg62-turbo (= 1:2.0.6-4), libjs-jquery (= 3.5.1+dfsg+~3.5.5-7), libk5crypto3 (= 1.18.3-5), libkeyutils1 (= 1.6.1-2), libkpathsea6 (= 2020.20200327.54578-7), libkrb5-3 (= 1.18.3-5), libkrb5support0 (= 1.18.3-5), liblcms2-2 (= 2.12~rc1-2), liblsan0 (= 10.2.1-6), liblz4-1 (= 1.9.3-2), liblzma5 (= 5.2.5-2), libmagic-mgc (= 1:5.39-3), libmagic1 (= 1:5.39-3), libmd0 (= 1.0.3-3), libmime-charset-perl (= 1.012.2-1), libmount-dev (= 2.36.1-7), libmount1 (= 2.36.1-7), libmpc3 (= 1.2.0-1), libmpdec3 (= 2.5.1-2), libmpfr6 (= 4.1.0-3), libncursesw6 (= 6.2+20201114-2), libnetpbm10 (= 2:10.0-15.4), libnettle8 (= 3.7.2-3), libnsl-dev (= 1.3.0-2), libnsl2 (= 1.3.0-2), libopenjp2-7 (= 2.4.0-3), libosp5 (= 1.5.2-13+b2), libp11-kit0 (= 0.23.22-1), libpam-modules (= 1.4.0-7), libpam-modules-bin (= 1.4.0-7), libpam-runtime (= 1.4.0-7), libpam0g (= 1.4.0-7), libpaper-utils (= 1.1.28+b1), libpaper1 (= 1.1.28+b1), libpcre16-3 (= 2:8.39-13), libpcre2-16-0 (= 10.36-2), libpcre2-32-0 (= 10.36-2), libpcre2-8-0 (= 10.36-2), libpcre2-dev (= 10.36-2), libpcre2-posix2 (= 10.36-2), libpcre3 (= 2:8.39-13), libpcre3-dev (= 2:8.39-13), libpcre32-3 (= 2:8.39-13), libpcrecpp0v5 (= 2:8.39-13), libperl5.32 (= 5.32.1-4), libpipeline1 (= 1.5.3-1), libpixman-1-0 (= 0.40.0-1), libpng16-16 (= 1.6.37-3), libptexenc1 (= 2020.20200327.54578-7), libpython3-stdlib (= 3.9.2-3), libpython3.9-minimal (= 3.9.2-1), libpython3.9-stdlib (= 3.9.2-1), libquadmath0 (= 10.2.1-6), libreadline8 (= 8.1-2), libseccomp2 (= 2.5.1-1), libselinux1 (= 3.1-3), libselinux1-dev (= 3.1-3), libsepol1 (= 3.1-1), libsepol1-dev (= 3.1-1), libsigsegv2 (= 2.13-1), libsm6 (= 2:1.2.3-1), libsmartcols1 (= 2.36.1-7), libsombok3 (= 2.4.0-2+b1), libsqlite3-0 (= 3.34.1-3), libssl1.1 (= 1.1.1k-1), libstdc++-10-dev (= 10.2.1-6), libstdc++6 (= 10.2.1-6), libsub-override-perl (= 0.09-2), libsynctex2 (= 2020.20200327.54578-7), libsystemd0 (= 247.3-5), libtasn1-6 (= 4.16.0-2), libteckit0 (= 2.5.10+ds1-3), libtexlua53 (= 2020.20200327.54578-7), libtexluajit2 (= 2020.20200327.54578-7), libthai-data (= 0.1.28-4), libthai0 (= 0.1.28-4), libtiff5 (= 4.2.0-1), libtinfo6 (= 6.2+20201114-2), libtirpc-common (= 1.3.1-1), libtirpc-dev (= 1.3.1-1), libtirpc3 (= 1.3.1-1), libtool (= 2.4.6-15), libtsan0 (= 10.2.1-6), libubsan1 (= 10.2.1-6), libuchardet0 (= 0.0.7-1), libudev1 (= 247.3-5), libunicode-linebreak-perl (= 0.0.20190101-1+b3), libunistring2 (= 0.9.10-4), libuuid1 (= 2.36.1-7), libwebp6 (= 0.6.1-2+b1), libx11-6 (= 2:1.7.1-1), libx11-data (= 2:1.7.1-1), libxau6 (= 1:1.0.9-1), libxaw7 (= 2:1.0.13-1.1), libxcb-render0 (= 1.14-3), libxcb-shm0 (= 1.14-3), libxcb1 (= 1.14-3), libxdmcp6 (= 1:1.1.2-3), libxext6 (= 2:1.3.3-1.1), libxi6 (= 2:1.7.10-1), libxml2 (= 2.9.10+dfsg-6.7), libxmu6 (= 2:1.1.2-2+b3), libxpm4 (= 1:3.5.12-1), libxrender1 (= 1:0.9.10-1), libxt6 (= 1:1.2.0-1), libzstd1 (= 1.4.8+dfsg-2.1), libzzip-0-13 (= 0.13.62-3.3), linux-libc-dev (= 5.10.40-1), lmodern (= 2.004.5-6.1), login (= 1:4.8.1-1), lsb-base (= 11.1.0), m4 (= 1.4.18-5), make (= 4.3-4.1), man-db (= 2.9.4-2), mawk (= 1.3.4.20200120-2), media-types (= 4.0.0), ncurses-base (= 6.2+20201114-2), ncurses-bin (= 6.2+20201114-2), netpbm (= 2:10.0-15.4), opensp (= 1.5.2-13+b2), patch (= 2.7.6-7), perl (= 5.32.1-4), perl-base (= 5.32.1-4), perl-modules-5.32 (= 5.32.1-4), pkg-config (= 0.29.2-1), po-debconf (= 1.0.21+nmu1), poppler-data (= 0.4.10-1), python3 (= 3.9.2-3), python3-distutils (= 3.9.2-1), python3-lib2to3 (= 3.9.2-1), python3-minimal (= 3.9.2-3), python3.9 (= 3.9.2-1), python3.9-minimal (= 3.9.2-1), readline-common (= 8.1-2), sed (= 4.7-1), sensible-utils (= 0.0.14), sgml-base (= 1.30), sgml-data (= 2.0.11+nmu1), sysvinit-utils (= 2.96-7), t1utils (= 1.41-4), tar (= 1.34+dfsg-1), tex-common (= 6.16), texlive-base (= 2020.20210202-3), texlive-binaries (= 2020.20200327.54578-7), texlive-extra-utils (= 2020.20210202-3), texlive-latex-base (= 2020.20210202-3), texlive-luatex (= 2020.20210202-3), texlive-plain-generic (= 2020.20210202-3), tzdata (= 2021a-1), ucf (= 3.0043), util-linux (= 2.36.1-7), uuid-dev (= 2.36.1-7), x11-common (= 1:7.7+22), xdg-utils (= 1.1.3-4.1), xfonts-encodings (= 1:1.0.4-2.1), xfonts-utils (= 1:7.7+6), xml-core (= 0.18+nmu1), xz-utils (= 5.2.5-2), zlib1g (= 1:1.2.11.dfsg-2), zlib1g-dev (= 1:1.2.11.dfsg-2) Environment: DEB_BUILD_OPTIONS="nocheck parallel=1" DEB_BUILD_PROFILES="cross nocheck" LANG="en_US.UTF-8" LC_ALL="C.UTF-8" SOURCE_DATE_EPOCH="1587225421" +------------------------------------------------------------------------------+ | Package contents | +------------------------------------------------------------------------------+ wise-dbgsym_2.4.1-23_armel.deb ------------------------------ new Debian package, version 2.0. size 7434776 bytes: control archive=1128 bytes. 812 bytes, 12 lines control 1354 bytes, 13 lines md5sums Package: wise-dbgsym Source: wise Version: 2.4.1-23 Auto-Built-Package: debug-symbols Architecture: armel Maintainer: Debian Med Packaging Team Installed-Size: 8990 Depends: wise (= 2.4.1-23) Section: debug Priority: optional Description: debug symbols for wise Build-Ids: 0d947bd535f93039baf3fa2fad2c1c3112049101 180902a34ebdc8bf24e16af277ada8700e7aae5b 1d99617072a99ea67319ee6d664078c689d91b8e 236929be280ce959e8f2159264b1ed966549bc54 381e787114a36010c97a9985d0b3493e918c501a 3a6312024fa33078b728d331126408d0da95081f 71a4fce7d6bd0edd131049661536c4b6defda8bf 93a22bb64511af6675c17d041cb4fadf2986be9c a10841e57591892f9e591d0fd1d129b94f88452c b6405d6a0913f52d84e07f503818a4e660ec4348 bb19c8afcf37f2cb147d352f2b229b7505c307a9 ea9b2415c55d6ac5db6b29e88c6146f554728cbb drwxr-xr-x root/root 0 2020-04-18 15:57 ./ drwxr-xr-x root/root 0 2020-04-18 15:57 ./usr/ drwxr-xr-x root/root 0 2020-04-18 15:57 ./usr/lib/ drwxr-xr-x root/root 0 2020-04-18 15:57 ./usr/lib/debug/ drwxr-xr-x root/root 0 2020-04-18 15:57 ./usr/lib/debug/.build-id/ drwxr-xr-x root/root 0 2020-04-18 15:57 ./usr/lib/debug/.build-id/0d/ -rw-r--r-- root/root 353864 2020-04-18 15:57 ./usr/lib/debug/.build-id/0d/947bd535f93039baf3fa2fad2c1c3112049101.debug drwxr-xr-x root/root 0 2020-04-18 15:57 ./usr/lib/debug/.build-id/18/ -rw-r--r-- root/root 332068 2020-04-18 15:57 ./usr/lib/debug/.build-id/18/0902a34ebdc8bf24e16af277ada8700e7aae5b.debug drwxr-xr-x root/root 0 2020-04-18 15:57 ./usr/lib/debug/.build-id/1d/ -rw-r--r-- root/root 1586620 2020-04-18 15:57 ./usr/lib/debug/.build-id/1d/99617072a99ea67319ee6d664078c689d91b8e.debug drwxr-xr-x root/root 0 2020-04-18 15:57 ./usr/lib/debug/.build-id/23/ -rw-r--r-- root/root 1586432 2020-04-18 15:57 ./usr/lib/debug/.build-id/23/6929be280ce959e8f2159264b1ed966549bc54.debug drwxr-xr-x root/root 0 2020-04-18 15:57 ./usr/lib/debug/.build-id/38/ -rw-r--r-- root/root 411640 2020-04-18 15:57 ./usr/lib/debug/.build-id/38/1e787114a36010c97a9985d0b3493e918c501a.debug drwxr-xr-x root/root 0 2020-04-18 15:57 ./usr/lib/debug/.build-id/3a/ -rw-r--r-- root/root 242528 2020-04-18 15:57 ./usr/lib/debug/.build-id/3a/6312024fa33078b728d331126408d0da95081f.debug drwxr-xr-x root/root 0 2020-04-18 15:57 ./usr/lib/debug/.build-id/71/ -rw-r--r-- root/root 510768 2020-04-18 15:57 ./usr/lib/debug/.build-id/71/a4fce7d6bd0edd131049661536c4b6defda8bf.debug drwxr-xr-x root/root 0 2020-04-18 15:57 ./usr/lib/debug/.build-id/93/ -rw-r--r-- root/root 1582496 2020-04-18 15:57 ./usr/lib/debug/.build-id/93/a22bb64511af6675c17d041cb4fadf2986be9c.debug drwxr-xr-x root/root 0 2020-04-18 15:57 ./usr/lib/debug/.build-id/a1/ -rw-r--r-- root/root 1590704 2020-04-18 15:57 ./usr/lib/debug/.build-id/a1/0841e57591892f9e591d0fd1d129b94f88452c.debug drwxr-xr-x root/root 0 2020-04-18 15:57 ./usr/lib/debug/.build-id/b6/ -rw-r--r-- root/root 228324 2020-04-18 15:57 ./usr/lib/debug/.build-id/b6/405d6a0913f52d84e07f503818a4e660ec4348.debug drwxr-xr-x root/root 0 2020-04-18 15:57 ./usr/lib/debug/.build-id/bb/ -rw-r--r-- root/root 323384 2020-04-18 15:57 ./usr/lib/debug/.build-id/bb/19c8afcf37f2cb147d352f2b229b7505c307a9.debug drwxr-xr-x root/root 0 2020-04-18 15:57 ./usr/lib/debug/.build-id/ea/ -rw-r--r-- root/root 336400 2020-04-18 15:57 ./usr/lib/debug/.build-id/ea/9b2415c55d6ac5db6b29e88c6146f554728cbb.debug drwxr-xr-x root/root 0 2020-04-18 15:57 ./usr/lib/debug/.dwz/ drwxr-xr-x root/root 0 2020-04-18 15:57 ./usr/lib/debug/.dwz/arm-linux-gnueabi/ -rw-r--r-- root/root 92092 2020-04-18 15:57 ./usr/lib/debug/.dwz/arm-linux-gnueabi/wise.debug drwxr-xr-x root/root 0 2020-04-18 15:57 ./usr/share/ drwxr-xr-x root/root 0 2020-04-18 15:57 ./usr/share/doc/ lrwxrwxrwx root/root 0 2020-04-18 15:57 ./usr/share/doc/wise-dbgsym -> wise wise_2.4.1-23_armel.deb ----------------------- new Debian package, version 2.0. size 761528 bytes: control archive=1960 bytes. 1720 bytes, 33 lines control 1742 bytes, 29 lines md5sums Package: wise Version: 2.4.1-23 Architecture: armel Maintainer: Debian Med Packaging Team Installed-Size: 8650 Depends: libc6 (>= 2.29), libglib2.0-0 (>= 2.12.0), wise-data (= 2.4.1-23) Suggests: wise-doc (= 2.4.1-23) Section: science Priority: optional Homepage: https://www.ebi.ac.uk/~birney/wise2/ Description: comparison of biopolymers, like DNA and protein sequences Wise2 is a package focused on comparisons of biopolymers, commonly DNA and protein sequences. There are many other packages which do this, probably the best known being BLAST package (from NCBI) and the Fasta package (from Bill Pearson). There are other packages, such as the HMMER package (Sean Eddy) or SAM package (UC Santa Cruz) focused on hidden Markov models (HMMs) of biopolymers. . Wise2's particular forte is the comparison of DNA sequence at the level of its protein translation. This comparison allows the simultaneous prediction of say gene structure with homology based alignment. . Wise2 also contains other algorithms, such as the venerable Smith-Waterman algorithm, or more modern ones such as Stephen Altschul's generalised gap penalties, or even experimental ones developed in house, such as dba. The development of these algorithms is due to the ease of developing such algorithms in the environment used by Wise2. . Wise2 has also been written with an eye for reuse and maintainability. Although it is a pure C package you can access its functionality directly in Perl. Parts of the package (or the entire package) can be used by other C or C++ programs without namespace clashes as all externally linked variables have the unique identifier Wise2 prepended. drwxr-xr-x root/root 0 2020-04-18 15:57 ./ drwxr-xr-x root/root 0 2020-04-18 15:57 ./usr/ drwxr-xr-x root/root 0 2020-04-18 15:57 ./usr/bin/ -rwxr-xr-x root/root 276120 2020-04-18 15:57 ./usr/bin/dba -rwxr-xr-x root/root 185936 2020-04-18 15:57 ./usr/bin/dnal -rwxr-xr-x root/root 1649716 2020-04-18 15:57 ./usr/bin/estwise -rwxr-xr-x root/root 1657992 2020-04-18 15:57 ./usr/bin/estwisedb -rwxr-xr-x root/root 1653892 2020-04-18 15:57 ./usr/bin/genewise -rwxr-xr-x root/root 1662144 2020-04-18 15:57 ./usr/bin/genewisedb -rwxr-xr-x root/root 304704 2020-04-18 15:57 ./usr/bin/genomewise -rwxr-xr-x root/root 325200 2020-04-18 15:57 ./usr/bin/promoterwise -rwxr-xr-x root/root 271952 2020-04-18 15:57 ./usr/bin/psw -rwxr-xr-x root/root 276120 2020-04-18 15:57 ./usr/bin/pswdb -rwxr-xr-x root/root 394832 2020-04-18 15:57 ./usr/bin/scanwise -rwxr-xr-x root/root 157252 2020-04-18 15:57 ./usr/bin/scanwise_server drwxr-xr-x root/root 0 2020-04-18 15:57 ./usr/share/ drwxr-xr-x root/root 0 2020-04-18 15:57 ./usr/share/doc/ drwxr-xr-x root/root 0 2020-04-18 15:57 ./usr/share/doc/wise/ -rw-r--r-- root/root 1973 2007-07-01 20:46 ./usr/share/doc/wise/README -rw-r--r-- root/root 320 2020-04-18 15:57 ./usr/share/doc/wise/README.Debian -rw-r--r-- root/root 3433 2020-04-18 15:57 ./usr/share/doc/wise/changelog.Debian.gz -rw-r--r-- root/root 4297 2020-04-18 15:57 ./usr/share/doc/wise/copyright -rw-r--r-- root/root 312 2020-04-18 15:57 ./usr/share/doc/wise/run-unit-test drwxr-xr-x root/root 0 2020-04-18 15:57 ./usr/share/man/ drwxr-xr-x root/root 0 2020-04-18 15:57 ./usr/share/man/man1/ -rw-r--r-- root/root 846 2020-04-18 15:57 ./usr/share/man/man1/dba.1.gz -rw-r--r-- root/root 557 2020-04-18 15:57 ./usr/share/man/man1/dnal.1.gz -rw-r--r-- root/root 595 2020-04-18 15:57 ./usr/share/man/man1/estwise.1.gz -rw-r--r-- root/root 594 2020-04-18 15:57 ./usr/share/man/man1/estwisedb.1.gz -rw-r--r-- root/root 594 2020-04-18 15:57 ./usr/share/man/man1/genewise.1.gz -rw-r--r-- root/root 595 2020-04-18 15:57 ./usr/share/man/man1/genewisedb.1.gz -rw-r--r-- root/root 605 2020-04-18 15:57 ./usr/share/man/man1/genomewise.1.gz -rw-r--r-- root/root 592 2020-04-18 15:57 ./usr/share/man/man1/promoterwise.1.gz -rw-r--r-- root/root 685 2020-04-18 15:57 ./usr/share/man/man1/psw.1.gz -rw-r--r-- root/root 585 2020-04-18 15:57 ./usr/share/man/man1/pswdb.1.gz -rw-r--r-- root/root 601 2020-04-18 15:57 ./usr/share/man/man1/scanwise.1.gz -rw-r--r-- root/root 584 2020-04-18 15:57 ./usr/share/man/man1/scanwise_server.1.gz lintian ------- Setup apt archive ----------------- Merged Build-Depends: lintian:amd64 Filtered Build-Depends: lintian:amd64 dpkg-deb: building package 'sbuild-build-depends-lintian-dummy' in '/<>/apt_archive/sbuild-build-depends-lintian-dummy.deb'. Ign:1 copy:/<>/apt_archive ./ InRelease Get:2 copy:/<>/apt_archive ./ Release [963 B] Ign:3 copy:/<>/apt_archive ./ Release.gpg Get:4 copy:/<>/apt_archive ./ Sources [578 B] Get:5 copy:/<>/apt_archive ./ Packages [665 B] Fetched 2206 B in 0s (91.8 kB/s) Reading package lists... Reading package lists... Install lintian build dependencies (apt-based resolver) ------------------------------------------------------- Installing build dependencies Reading package lists... Building dependency tree... Reading state information... The following additional packages will be installed: diffstat gpg gpgconf libaliased-perl libapt-pkg-perl libassuan0 libb-hooks-endofscope-perl libb-hooks-op-check-perl libcapture-tiny-perl libclass-data-inheritable-perl libclass-method-modifiers-perl libclass-xsaccessor-perl libclone-perl libconfig-tiny-perl libcpanel-json-xs-perl libdata-dpath-perl libdata-messagepack-perl libdata-optlist-perl libdata-validate-domain-perl libdevel-callchecker-perl libdevel-size-perl libdevel-stacktrace-perl libdynaloader-functions-perl libemail-address-xs-perl libexception-class-perl libexporter-tiny-perl libfile-basedir-perl libfile-find-rule-perl libfont-ttf-perl libhtml-html5-entities-perl libimport-into-perl libipc-run3-perl libipc-system-simple-perl libiterator-perl libiterator-util-perl libjson-maybexs-perl liblist-compare-perl liblist-moreutils-perl liblist-moreutils-xs-perl liblist-utilsby-perl liblzo2-2 libmarkdown2 libmodule-implementation-perl libmodule-runtime-perl libmoo-perl libmoox-aliases-perl libmouse-perl libnamespace-clean-perl libnet-domain-tld-perl libnumber-compare-perl libpackage-stash-perl libparams-classify-perl libparams-util-perl libpath-tiny-perl libperlio-gzip-perl libproc-processtable-perl librole-tiny-perl libsereal-decoder-perl libsereal-encoder-perl libstrictures-perl libsub-exporter-perl libsub-exporter-progressive-perl libsub-identify-perl libsub-install-perl libsub-name-perl libsub-quote-perl libtext-glob-perl libtext-levenshteinxs-perl libtext-markdown-discount-perl libtext-xslate-perl libtime-duration-perl libtime-moment-perl libtimedate-perl libtry-tiny-perl libtype-tiny-perl libunicode-utf8-perl liburi-perl libvariable-magic-perl libyaml-0-2 libyaml-libyaml-perl lintian lzip lzop patchutils unzip Suggested packages: libxml-parser-perl libscalar-number-perl libbareword-filehandles-perl libindirect-perl libmultidimensional-perl libdevel-lexalias-perl libwww-perl binutils-multiarch libtext-template-perl zip Recommended packages: gnupg libpackage-stash-xs-perl libref-util-perl libtype-tiny-xs-perl The following NEW packages will be installed: diffstat gpg gpgconf libaliased-perl libapt-pkg-perl libassuan0 libb-hooks-endofscope-perl libb-hooks-op-check-perl libcapture-tiny-perl libclass-data-inheritable-perl libclass-method-modifiers-perl libclass-xsaccessor-perl libclone-perl libconfig-tiny-perl libcpanel-json-xs-perl libdata-dpath-perl libdata-messagepack-perl libdata-optlist-perl libdata-validate-domain-perl libdevel-callchecker-perl libdevel-size-perl libdevel-stacktrace-perl libdynaloader-functions-perl libemail-address-xs-perl libexception-class-perl libexporter-tiny-perl libfile-basedir-perl libfile-find-rule-perl libfont-ttf-perl libhtml-html5-entities-perl libimport-into-perl libipc-run3-perl libipc-system-simple-perl libiterator-perl libiterator-util-perl libjson-maybexs-perl liblist-compare-perl liblist-moreutils-perl liblist-moreutils-xs-perl liblist-utilsby-perl liblzo2-2 libmarkdown2 libmodule-implementation-perl libmodule-runtime-perl libmoo-perl libmoox-aliases-perl libmouse-perl libnamespace-clean-perl libnet-domain-tld-perl libnumber-compare-perl libpackage-stash-perl libparams-classify-perl libparams-util-perl libpath-tiny-perl libperlio-gzip-perl libproc-processtable-perl librole-tiny-perl libsereal-decoder-perl libsereal-encoder-perl libstrictures-perl libsub-exporter-perl libsub-exporter-progressive-perl libsub-identify-perl libsub-install-perl libsub-name-perl libsub-quote-perl libtext-glob-perl libtext-levenshteinxs-perl libtext-markdown-discount-perl libtext-xslate-perl libtime-duration-perl libtime-moment-perl libtimedate-perl libtry-tiny-perl libtype-tiny-perl libunicode-utf8-perl liburi-perl libvariable-magic-perl libyaml-0-2 libyaml-libyaml-perl lintian lzip lzop patchutils sbuild-build-depends-lintian-dummy:armel unzip 0 upgraded, 86 newly installed, 0 to remove and 0 not upgraded. Need to get 6526 kB of archives. After this operation, 19.2 MB of additional disk space will be used. Get:1 copy:/<>/apt_archive ./ sbuild-build-depends-lintian-dummy 0.invalid.0 [848 B] Get:2 http://debian.oregonstate.edu/debian unstable/main amd64 diffstat amd64 1.64-1 [36.6 kB] Get:3 http://debian.oregonstate.edu/debian unstable/main amd64 libassuan0 amd64 2.5.4-1 [51.1 kB] Get:4 http://debian.oregonstate.edu/debian unstable/main amd64 gpgconf amd64 2.2.27-2 [547 kB] Get:5 http://debian.oregonstate.edu/debian unstable/main amd64 gpg amd64 2.2.27-2 [927 kB] Get:6 http://debian.oregonstate.edu/debian unstable/main amd64 libaliased-perl all 0.34-1.1 [14.1 kB] Get:7 http://debian.oregonstate.edu/debian unstable/main amd64 libapt-pkg-perl amd64 0.1.40 [72.2 kB] Get:8 http://debian.oregonstate.edu/debian unstable/main amd64 libb-hooks-op-check-perl amd64 0.22-1+b3 [11.3 kB] Get:9 http://debian.oregonstate.edu/debian unstable/main amd64 libdynaloader-functions-perl all 0.003-1.1 [12.7 kB] Get:10 http://debian.oregonstate.edu/debian unstable/main amd64 libdevel-callchecker-perl amd64 0.008-1+b2 [15.9 kB] Get:11 http://debian.oregonstate.edu/debian unstable/main amd64 libparams-classify-perl amd64 0.015-1+b3 [25.7 kB] Get:12 http://debian.oregonstate.edu/debian unstable/main amd64 libmodule-runtime-perl all 0.016-1 [19.4 kB] Get:13 http://debian.oregonstate.edu/debian unstable/main amd64 libtry-tiny-perl all 0.30-1 [23.3 kB] Get:14 http://debian.oregonstate.edu/debian unstable/main amd64 libmodule-implementation-perl all 0.09-1.1 [12.4 kB] Get:15 http://debian.oregonstate.edu/debian unstable/main amd64 libsub-exporter-progressive-perl all 0.001013-1 [7588 B] Get:16 http://debian.oregonstate.edu/debian unstable/main amd64 libvariable-magic-perl amd64 0.62-1+b3 [45.7 kB] Get:17 http://debian.oregonstate.edu/debian unstable/main amd64 libb-hooks-endofscope-perl all 0.24-1.1 [18.9 kB] Get:18 http://debian.oregonstate.edu/debian unstable/main amd64 libcapture-tiny-perl all 0.48-1 [26.0 kB] Get:19 http://debian.oregonstate.edu/debian unstable/main amd64 libclass-data-inheritable-perl all 0.08-3 [8588 B] Get:20 http://debian.oregonstate.edu/debian unstable/main amd64 libclass-method-modifiers-perl all 2.13-1 [19.2 kB] Get:21 http://debian.oregonstate.edu/debian unstable/main amd64 libclass-xsaccessor-perl amd64 1.19-3+b7 [38.1 kB] Get:22 http://debian.oregonstate.edu/debian unstable/main amd64 libclone-perl amd64 0.45-1+b1 [15.4 kB] Get:23 http://debian.oregonstate.edu/debian unstable/main amd64 libconfig-tiny-perl all 2.26-1 [16.5 kB] Get:24 http://debian.oregonstate.edu/debian unstable/main amd64 libcpanel-json-xs-perl amd64 4.25-1+b1 [129 kB] Get:25 http://debian.oregonstate.edu/debian unstable/main amd64 libdevel-stacktrace-perl all 2.0400-1 [28.6 kB] Get:26 http://debian.oregonstate.edu/debian unstable/main amd64 libexception-class-perl all 1.44-1 [32.3 kB] Get:27 http://debian.oregonstate.edu/debian unstable/main amd64 libiterator-perl all 0.03+ds1-1.1 [18.4 kB] Get:28 http://debian.oregonstate.edu/debian unstable/main amd64 libiterator-util-perl all 0.02+ds1-1.1 [13.7 kB] Get:29 http://debian.oregonstate.edu/debian unstable/main amd64 libexporter-tiny-perl all 1.002002-1 [37.8 kB] Get:30 http://debian.oregonstate.edu/debian unstable/main amd64 liblist-moreutils-xs-perl amd64 0.430-2 [40.9 kB] Get:31 http://debian.oregonstate.edu/debian unstable/main amd64 liblist-moreutils-perl all 0.430-2 [46.9 kB] Get:32 http://debian.oregonstate.edu/debian unstable/main amd64 libparams-util-perl amd64 1.102-1+b1 [25.6 kB] Get:33 http://debian.oregonstate.edu/debian unstable/main amd64 libsub-install-perl all 0.928-1.1 [10.8 kB] Get:34 http://debian.oregonstate.edu/debian unstable/main amd64 libdata-optlist-perl all 0.110-1.1 [10.8 kB] Get:35 http://debian.oregonstate.edu/debian unstable/main amd64 libsub-exporter-perl all 0.987-1 [47.2 kB] Get:36 http://debian.oregonstate.edu/debian unstable/main amd64 libdata-dpath-perl all 0.58-1 [43.5 kB] Get:37 http://debian.oregonstate.edu/debian unstable/main amd64 libdata-messagepack-perl amd64 1.00-4+b1 [38.8 kB] Get:38 http://debian.oregonstate.edu/debian unstable/main amd64 libnet-domain-tld-perl all 1.75-1.1 [33.5 kB] Get:39 http://debian.oregonstate.edu/debian unstable/main amd64 libdata-validate-domain-perl all 0.10-1.1 [11.1 kB] Get:40 http://debian.oregonstate.edu/debian unstable/main amd64 libdevel-size-perl amd64 0.83-1+b2 [26.1 kB] Get:41 http://debian.oregonstate.edu/debian unstable/main amd64 libemail-address-xs-perl amd64 1.04-1+b3 [28.0 kB] Get:42 http://debian.oregonstate.edu/debian unstable/main amd64 libipc-system-simple-perl all 1.30-1 [28.2 kB] Get:43 http://debian.oregonstate.edu/debian unstable/main amd64 libfile-basedir-perl all 0.08-1 [17.7 kB] Get:44 http://debian.oregonstate.edu/debian unstable/main amd64 libnumber-compare-perl all 0.03-1.1 [6956 B] Get:45 http://debian.oregonstate.edu/debian unstable/main amd64 libtext-glob-perl all 0.11-1 [8888 B] Get:46 http://debian.oregonstate.edu/debian unstable/main amd64 libfile-find-rule-perl all 0.34-1 [30.6 kB] Get:47 http://debian.oregonstate.edu/debian unstable/main amd64 libfont-ttf-perl all 1.06-1.1 [318 kB] Get:48 http://debian.oregonstate.edu/debian unstable/main amd64 libhtml-html5-entities-perl all 0.004-1.1 [21.3 kB] Get:49 http://debian.oregonstate.edu/debian unstable/main amd64 libimport-into-perl all 1.002005-1 [11.6 kB] Get:50 http://debian.oregonstate.edu/debian unstable/main amd64 libipc-run3-perl all 0.048-2 [34.2 kB] Get:51 http://debian.oregonstate.edu/debian unstable/main amd64 libjson-maybexs-perl all 1.004003-1 [13.1 kB] Get:52 http://debian.oregonstate.edu/debian unstable/main amd64 liblist-compare-perl all 0.55-1 [66.9 kB] Get:53 http://debian.oregonstate.edu/debian unstable/main amd64 liblist-utilsby-perl all 0.11-1 [15.4 kB] Get:54 http://debian.oregonstate.edu/debian unstable/main amd64 liblzo2-2 amd64 2.10-2 [56.9 kB] Get:55 http://debian.oregonstate.edu/debian unstable/main amd64 libmarkdown2 amd64 2.2.6-1 [36.8 kB] Get:56 http://debian.oregonstate.edu/debian unstable/main amd64 librole-tiny-perl all 2.002004-1 [21.4 kB] Get:57 http://debian.oregonstate.edu/debian unstable/main amd64 libstrictures-perl all 2.000006-1 [18.6 kB] Get:58 http://debian.oregonstate.edu/debian unstable/main amd64 libsub-quote-perl all 2.006006-1 [21.0 kB] Get:59 http://debian.oregonstate.edu/debian unstable/main amd64 libmoo-perl all 2.004004-1 [59.9 kB] Get:60 http://debian.oregonstate.edu/debian unstable/main amd64 libmoox-aliases-perl all 0.001006-1.1 [10.8 kB] Get:61 http://debian.oregonstate.edu/debian unstable/main amd64 libmouse-perl amd64 2.5.10-1+b1 [172 kB] Get:62 http://debian.oregonstate.edu/debian unstable/main amd64 libpackage-stash-perl all 0.39-1 [21.9 kB] Get:63 http://debian.oregonstate.edu/debian unstable/main amd64 libsub-identify-perl amd64 0.14-1+b3 [12.0 kB] Get:64 http://debian.oregonstate.edu/debian unstable/main amd64 libsub-name-perl amd64 0.26-1+b1 [13.8 kB] Get:65 http://debian.oregonstate.edu/debian unstable/main amd64 libnamespace-clean-perl all 0.27-1 [17.3 kB] Get:66 http://debian.oregonstate.edu/debian unstable/main amd64 libpath-tiny-perl all 0.118-1 [53.5 kB] Get:67 http://debian.oregonstate.edu/debian unstable/main amd64 libperlio-gzip-perl amd64 0.19-1+b7 [17.4 kB] Get:68 http://debian.oregonstate.edu/debian unstable/main amd64 libproc-processtable-perl amd64 0.59-2+b1 [45.9 kB] Get:69 http://debian.oregonstate.edu/debian unstable/main amd64 libsereal-decoder-perl amd64 4.018+ds-1+b1 [99.3 kB] Get:70 http://debian.oregonstate.edu/debian unstable/main amd64 libsereal-encoder-perl amd64 4.018+ds-1+b1 [103 kB] Get:71 http://debian.oregonstate.edu/debian unstable/main amd64 libtext-levenshteinxs-perl amd64 0.03-4+b8 [8724 B] Get:72 http://debian.oregonstate.edu/debian unstable/main amd64 libtext-markdown-discount-perl amd64 0.12-1+b1 [13.0 kB] Get:73 http://debian.oregonstate.edu/debian unstable/main amd64 libtext-xslate-perl amd64 3.5.8-1+b1 [197 kB] Get:74 http://debian.oregonstate.edu/debian unstable/main amd64 libtime-duration-perl all 1.21-1 [13.7 kB] Get:75 http://debian.oregonstate.edu/debian unstable/main amd64 libtime-moment-perl amd64 0.44-1+b3 [75.8 kB] Get:76 http://debian.oregonstate.edu/debian unstable/main amd64 libtimedate-perl all 2.3300-2 [39.3 kB] Get:77 http://debian.oregonstate.edu/debian unstable/main amd64 libtype-tiny-perl all 1.012002-1 [351 kB] Get:78 http://debian.oregonstate.edu/debian unstable/main amd64 libunicode-utf8-perl amd64 0.62-1+b2 [20.3 kB] Get:79 http://debian.oregonstate.edu/debian unstable/main amd64 liburi-perl all 5.08-1 [90.6 kB] Get:80 http://debian.oregonstate.edu/debian unstable/main amd64 libyaml-0-2 amd64 0.2.2-1 [49.6 kB] Get:81 http://debian.oregonstate.edu/debian unstable/main amd64 libyaml-libyaml-perl amd64 0.82+repack-1+b1 [35.8 kB] Get:82 http://debian.oregonstate.edu/debian unstable/main amd64 lzip amd64 1.22-3 [88.5 kB] Get:83 http://debian.oregonstate.edu/debian unstable/main amd64 lzop amd64 1.04-2 [84.2 kB] Get:84 http://debian.oregonstate.edu/debian unstable/main amd64 patchutils amd64 0.4.2-1 [77.5 kB] Get:85 http://debian.oregonstate.edu/debian unstable/main amd64 unzip amd64 6.0-26 [171 kB] Get:86 http://debian.oregonstate.edu/debian unstable/main amd64 lintian all 2.104.0 [1265 kB] debconf: delaying package configuration, since apt-utils is not installed Fetched 6526 kB in 0s (30.7 MB/s) Selecting previously unselected package diffstat. (Reading database ... 44205 files and directories currently installed.) Preparing to unpack .../00-diffstat_1.64-1_amd64.deb ... Unpacking diffstat (1.64-1) ... Selecting previously unselected package libassuan0:amd64. Preparing to unpack .../01-libassuan0_2.5.4-1_amd64.deb ... Unpacking libassuan0:amd64 (2.5.4-1) ... Selecting previously unselected package gpgconf. Preparing to unpack .../02-gpgconf_2.2.27-2_amd64.deb ... Unpacking gpgconf (2.2.27-2) ... Selecting previously unselected package gpg. Preparing to unpack .../03-gpg_2.2.27-2_amd64.deb ... Unpacking gpg (2.2.27-2) ... Selecting previously unselected package libaliased-perl. Preparing to unpack .../04-libaliased-perl_0.34-1.1_all.deb ... Unpacking libaliased-perl (0.34-1.1) ... Selecting previously unselected package libapt-pkg-perl. Preparing to unpack .../05-libapt-pkg-perl_0.1.40_amd64.deb ... Unpacking libapt-pkg-perl (0.1.40) ... Selecting previously unselected package libb-hooks-op-check-perl. Preparing to unpack .../06-libb-hooks-op-check-perl_0.22-1+b3_amd64.deb ... Unpacking libb-hooks-op-check-perl (0.22-1+b3) ... Selecting previously unselected package libdynaloader-functions-perl. Preparing to unpack .../07-libdynaloader-functions-perl_0.003-1.1_all.deb ... Unpacking libdynaloader-functions-perl (0.003-1.1) ... Selecting previously unselected package libdevel-callchecker-perl. Preparing to unpack .../08-libdevel-callchecker-perl_0.008-1+b2_amd64.deb ... Unpacking libdevel-callchecker-perl (0.008-1+b2) ... Selecting previously unselected package libparams-classify-perl. Preparing to unpack .../09-libparams-classify-perl_0.015-1+b3_amd64.deb ... Unpacking libparams-classify-perl (0.015-1+b3) ... Selecting previously unselected package libmodule-runtime-perl. Preparing to unpack .../10-libmodule-runtime-perl_0.016-1_all.deb ... Unpacking libmodule-runtime-perl (0.016-1) ... Selecting previously unselected package libtry-tiny-perl. Preparing to unpack .../11-libtry-tiny-perl_0.30-1_all.deb ... Unpacking libtry-tiny-perl (0.30-1) ... Selecting previously unselected package libmodule-implementation-perl. Preparing to unpack .../12-libmodule-implementation-perl_0.09-1.1_all.deb ... Unpacking libmodule-implementation-perl (0.09-1.1) ... Selecting previously unselected package libsub-exporter-progressive-perl. Preparing to unpack .../13-libsub-exporter-progressive-perl_0.001013-1_all.deb ... Unpacking libsub-exporter-progressive-perl (0.001013-1) ... Selecting previously unselected package libvariable-magic-perl. Preparing to unpack .../14-libvariable-magic-perl_0.62-1+b3_amd64.deb ... Unpacking libvariable-magic-perl (0.62-1+b3) ... Selecting previously unselected package libb-hooks-endofscope-perl. Preparing to unpack .../15-libb-hooks-endofscope-perl_0.24-1.1_all.deb ... Unpacking libb-hooks-endofscope-perl (0.24-1.1) ... Selecting previously unselected package libcapture-tiny-perl. Preparing to unpack .../16-libcapture-tiny-perl_0.48-1_all.deb ... Unpacking libcapture-tiny-perl (0.48-1) ... Selecting previously unselected package libclass-data-inheritable-perl. Preparing to unpack .../17-libclass-data-inheritable-perl_0.08-3_all.deb ... Unpacking libclass-data-inheritable-perl (0.08-3) ... Selecting previously unselected package libclass-method-modifiers-perl. Preparing to unpack .../18-libclass-method-modifiers-perl_2.13-1_all.deb ... Unpacking libclass-method-modifiers-perl (2.13-1) ... Selecting previously unselected package libclass-xsaccessor-perl. Preparing to unpack .../19-libclass-xsaccessor-perl_1.19-3+b7_amd64.deb ... Unpacking libclass-xsaccessor-perl (1.19-3+b7) ... Selecting previously unselected package libclone-perl. Preparing to unpack .../20-libclone-perl_0.45-1+b1_amd64.deb ... Unpacking libclone-perl (0.45-1+b1) ... Selecting previously unselected package libconfig-tiny-perl. Preparing to unpack .../21-libconfig-tiny-perl_2.26-1_all.deb ... Unpacking libconfig-tiny-perl (2.26-1) ... Selecting previously unselected package libcpanel-json-xs-perl. Preparing to unpack .../22-libcpanel-json-xs-perl_4.25-1+b1_amd64.deb ... Unpacking libcpanel-json-xs-perl (4.25-1+b1) ... Selecting previously unselected package libdevel-stacktrace-perl. Preparing to unpack .../23-libdevel-stacktrace-perl_2.0400-1_all.deb ... Unpacking libdevel-stacktrace-perl (2.0400-1) ... Selecting previously unselected package libexception-class-perl. Preparing to unpack .../24-libexception-class-perl_1.44-1_all.deb ... Unpacking libexception-class-perl (1.44-1) ... Selecting previously unselected package libiterator-perl. Preparing to unpack .../25-libiterator-perl_0.03+ds1-1.1_all.deb ... Unpacking libiterator-perl (0.03+ds1-1.1) ... Selecting previously unselected package libiterator-util-perl. Preparing to unpack .../26-libiterator-util-perl_0.02+ds1-1.1_all.deb ... Unpacking libiterator-util-perl (0.02+ds1-1.1) ... Selecting previously unselected package libexporter-tiny-perl. Preparing to unpack .../27-libexporter-tiny-perl_1.002002-1_all.deb ... Unpacking libexporter-tiny-perl (1.002002-1) ... Selecting previously unselected package liblist-moreutils-xs-perl. Preparing to unpack .../28-liblist-moreutils-xs-perl_0.430-2_amd64.deb ... Unpacking liblist-moreutils-xs-perl (0.430-2) ... Selecting previously unselected package liblist-moreutils-perl. Preparing to unpack .../29-liblist-moreutils-perl_0.430-2_all.deb ... Unpacking liblist-moreutils-perl (0.430-2) ... Selecting previously unselected package libparams-util-perl. Preparing to unpack .../30-libparams-util-perl_1.102-1+b1_amd64.deb ... Unpacking libparams-util-perl (1.102-1+b1) ... Selecting previously unselected package libsub-install-perl. Preparing to unpack .../31-libsub-install-perl_0.928-1.1_all.deb ... Unpacking libsub-install-perl (0.928-1.1) ... Selecting previously unselected package libdata-optlist-perl. Preparing to unpack .../32-libdata-optlist-perl_0.110-1.1_all.deb ... Unpacking libdata-optlist-perl (0.110-1.1) ... Selecting previously unselected package libsub-exporter-perl. Preparing to unpack .../33-libsub-exporter-perl_0.987-1_all.deb ... Unpacking libsub-exporter-perl (0.987-1) ... Selecting previously unselected package libdata-dpath-perl. Preparing to unpack .../34-libdata-dpath-perl_0.58-1_all.deb ... Unpacking libdata-dpath-perl (0.58-1) ... Selecting previously unselected package libdata-messagepack-perl. Preparing to unpack .../35-libdata-messagepack-perl_1.00-4+b1_amd64.deb ... Unpacking libdata-messagepack-perl (1.00-4+b1) ... Selecting previously unselected package libnet-domain-tld-perl. Preparing to unpack .../36-libnet-domain-tld-perl_1.75-1.1_all.deb ... Unpacking libnet-domain-tld-perl (1.75-1.1) ... Selecting previously unselected package libdata-validate-domain-perl. Preparing to unpack .../37-libdata-validate-domain-perl_0.10-1.1_all.deb ... Unpacking libdata-validate-domain-perl (0.10-1.1) ... Selecting previously unselected package libdevel-size-perl. Preparing to unpack .../38-libdevel-size-perl_0.83-1+b2_amd64.deb ... Unpacking libdevel-size-perl (0.83-1+b2) ... Selecting previously unselected package libemail-address-xs-perl. Preparing to unpack .../39-libemail-address-xs-perl_1.04-1+b3_amd64.deb ... Unpacking libemail-address-xs-perl (1.04-1+b3) ... Selecting previously unselected package libipc-system-simple-perl. Preparing to unpack .../40-libipc-system-simple-perl_1.30-1_all.deb ... Unpacking libipc-system-simple-perl (1.30-1) ... Selecting previously unselected package libfile-basedir-perl. Preparing to unpack .../41-libfile-basedir-perl_0.08-1_all.deb ... Unpacking libfile-basedir-perl (0.08-1) ... Selecting previously unselected package libnumber-compare-perl. Preparing to unpack .../42-libnumber-compare-perl_0.03-1.1_all.deb ... Unpacking libnumber-compare-perl (0.03-1.1) ... Selecting previously unselected package libtext-glob-perl. Preparing to unpack .../43-libtext-glob-perl_0.11-1_all.deb ... Unpacking libtext-glob-perl (0.11-1) ... Selecting previously unselected package libfile-find-rule-perl. Preparing to unpack .../44-libfile-find-rule-perl_0.34-1_all.deb ... Unpacking libfile-find-rule-perl (0.34-1) ... Selecting previously unselected package libfont-ttf-perl. Preparing to unpack .../45-libfont-ttf-perl_1.06-1.1_all.deb ... Unpacking libfont-ttf-perl (1.06-1.1) ... Selecting previously unselected package libhtml-html5-entities-perl. Preparing to unpack .../46-libhtml-html5-entities-perl_0.004-1.1_all.deb ... Unpacking libhtml-html5-entities-perl (0.004-1.1) ... Selecting previously unselected package libimport-into-perl. Preparing to unpack .../47-libimport-into-perl_1.002005-1_all.deb ... Unpacking libimport-into-perl (1.002005-1) ... Selecting previously unselected package libipc-run3-perl. Preparing to unpack .../48-libipc-run3-perl_0.048-2_all.deb ... Unpacking libipc-run3-perl (0.048-2) ... Selecting previously unselected package libjson-maybexs-perl. Preparing to unpack .../49-libjson-maybexs-perl_1.004003-1_all.deb ... Unpacking libjson-maybexs-perl (1.004003-1) ... Selecting previously unselected package liblist-compare-perl. Preparing to unpack .../50-liblist-compare-perl_0.55-1_all.deb ... Unpacking liblist-compare-perl (0.55-1) ... Selecting previously unselected package liblist-utilsby-perl. Preparing to unpack .../51-liblist-utilsby-perl_0.11-1_all.deb ... Unpacking liblist-utilsby-perl (0.11-1) ... Selecting previously unselected package liblzo2-2:amd64. Preparing to unpack .../52-liblzo2-2_2.10-2_amd64.deb ... Unpacking liblzo2-2:amd64 (2.10-2) ... Selecting previously unselected package libmarkdown2:amd64. Preparing to unpack .../53-libmarkdown2_2.2.6-1_amd64.deb ... Unpacking libmarkdown2:amd64 (2.2.6-1) ... Selecting previously unselected package librole-tiny-perl. Preparing to unpack .../54-librole-tiny-perl_2.002004-1_all.deb ... Unpacking librole-tiny-perl (2.002004-1) ... Selecting previously unselected package libstrictures-perl. Preparing to unpack .../55-libstrictures-perl_2.000006-1_all.deb ... Unpacking libstrictures-perl (2.000006-1) ... Selecting previously unselected package libsub-quote-perl. Preparing to unpack .../56-libsub-quote-perl_2.006006-1_all.deb ... Unpacking libsub-quote-perl (2.006006-1) ... Selecting previously unselected package libmoo-perl. Preparing to unpack .../57-libmoo-perl_2.004004-1_all.deb ... Unpacking libmoo-perl (2.004004-1) ... Selecting previously unselected package libmoox-aliases-perl. Preparing to unpack .../58-libmoox-aliases-perl_0.001006-1.1_all.deb ... Unpacking libmoox-aliases-perl (0.001006-1.1) ... Selecting previously unselected package libmouse-perl. Preparing to unpack .../59-libmouse-perl_2.5.10-1+b1_amd64.deb ... Unpacking libmouse-perl (2.5.10-1+b1) ... Selecting previously unselected package libpackage-stash-perl. Preparing to unpack .../60-libpackage-stash-perl_0.39-1_all.deb ... Unpacking libpackage-stash-perl (0.39-1) ... Selecting previously unselected package libsub-identify-perl. Preparing to unpack .../61-libsub-identify-perl_0.14-1+b3_amd64.deb ... Unpacking libsub-identify-perl (0.14-1+b3) ... Selecting previously unselected package libsub-name-perl. Preparing to unpack .../62-libsub-name-perl_0.26-1+b1_amd64.deb ... Unpacking libsub-name-perl (0.26-1+b1) ... Selecting previously unselected package libnamespace-clean-perl. Preparing to unpack .../63-libnamespace-clean-perl_0.27-1_all.deb ... Unpacking libnamespace-clean-perl (0.27-1) ... Selecting previously unselected package libpath-tiny-perl. Preparing to unpack .../64-libpath-tiny-perl_0.118-1_all.deb ... Unpacking libpath-tiny-perl (0.118-1) ... Selecting previously unselected package libperlio-gzip-perl. Preparing to unpack .../65-libperlio-gzip-perl_0.19-1+b7_amd64.deb ... Unpacking libperlio-gzip-perl (0.19-1+b7) ... Selecting previously unselected package libproc-processtable-perl. Preparing to unpack .../66-libproc-processtable-perl_0.59-2+b1_amd64.deb ... Unpacking libproc-processtable-perl (0.59-2+b1) ... Selecting previously unselected package libsereal-decoder-perl. Preparing to unpack .../67-libsereal-decoder-perl_4.018+ds-1+b1_amd64.deb ... Unpacking libsereal-decoder-perl (4.018+ds-1+b1) ... Selecting previously unselected package libsereal-encoder-perl. Preparing to unpack .../68-libsereal-encoder-perl_4.018+ds-1+b1_amd64.deb ... Unpacking libsereal-encoder-perl (4.018+ds-1+b1) ... Selecting previously unselected package libtext-levenshteinxs-perl. Preparing to unpack .../69-libtext-levenshteinxs-perl_0.03-4+b8_amd64.deb ... Unpacking libtext-levenshteinxs-perl (0.03-4+b8) ... Selecting previously unselected package libtext-markdown-discount-perl:amd64. Preparing to unpack .../70-libtext-markdown-discount-perl_0.12-1+b1_amd64.deb ... Unpacking libtext-markdown-discount-perl:amd64 (0.12-1+b1) ... Selecting previously unselected package libtext-xslate-perl. Preparing to unpack .../71-libtext-xslate-perl_3.5.8-1+b1_amd64.deb ... Unpacking libtext-xslate-perl (3.5.8-1+b1) ... Selecting previously unselected package libtime-duration-perl. Preparing to unpack .../72-libtime-duration-perl_1.21-1_all.deb ... Unpacking libtime-duration-perl (1.21-1) ... Selecting previously unselected package libtime-moment-perl. Preparing to unpack .../73-libtime-moment-perl_0.44-1+b3_amd64.deb ... Unpacking libtime-moment-perl (0.44-1+b3) ... Selecting previously unselected package libtimedate-perl. Preparing to unpack .../74-libtimedate-perl_2.3300-2_all.deb ... Unpacking libtimedate-perl (2.3300-2) ... Selecting previously unselected package libtype-tiny-perl. Preparing to unpack .../75-libtype-tiny-perl_1.012002-1_all.deb ... Unpacking libtype-tiny-perl (1.012002-1) ... Selecting previously unselected package libunicode-utf8-perl. Preparing to unpack .../76-libunicode-utf8-perl_0.62-1+b2_amd64.deb ... Unpacking libunicode-utf8-perl (0.62-1+b2) ... Selecting previously unselected package liburi-perl. Preparing to unpack .../77-liburi-perl_5.08-1_all.deb ... Unpacking liburi-perl (5.08-1) ... Selecting previously unselected package libyaml-0-2:amd64. Preparing to unpack .../78-libyaml-0-2_0.2.2-1_amd64.deb ... Unpacking libyaml-0-2:amd64 (0.2.2-1) ... Selecting previously unselected package libyaml-libyaml-perl. Preparing to unpack .../79-libyaml-libyaml-perl_0.82+repack-1+b1_amd64.deb ... Unpacking libyaml-libyaml-perl (0.82+repack-1+b1) ... Selecting previously unselected package lzip. Preparing to unpack .../80-lzip_1.22-3_amd64.deb ... Unpacking lzip (1.22-3) ... Selecting previously unselected package lzop. Preparing to unpack .../81-lzop_1.04-2_amd64.deb ... Unpacking lzop (1.04-2) ... Selecting previously unselected package patchutils. Preparing to unpack .../82-patchutils_0.4.2-1_amd64.deb ... Unpacking patchutils (0.4.2-1) ... Selecting previously unselected package unzip. Preparing to unpack .../83-unzip_6.0-26_amd64.deb ... Unpacking unzip (6.0-26) ... Selecting previously unselected package lintian. Preparing to unpack .../84-lintian_2.104.0_all.deb ... Unpacking lintian (2.104.0) ... Selecting previously unselected package sbuild-build-depends-lintian-dummy:armel. Preparing to unpack .../85-sbuild-build-depends-lintian-dummy_0.invalid.0_armel.deb ... Unpacking sbuild-build-depends-lintian-dummy:armel (0.invalid.0) ... Setting up libapt-pkg-perl (0.1.40) ... Setting up libunicode-utf8-perl (0.62-1+b2) ... Setting up libmouse-perl (2.5.10-1+b1) ... Setting up libdata-messagepack-perl (1.00-4+b1) ... Setting up libdynaloader-functions-perl (0.003-1.1) ... Setting up libtext-glob-perl (0.11-1) ... Setting up libclass-method-modifiers-perl (2.13-1) ... Setting up liblist-compare-perl (0.55-1) ... Setting up libclone-perl (0.45-1+b1) ... Setting up libyaml-0-2:amd64 (0.2.2-1) ... Setting up libsub-identify-perl (0.14-1+b3) ... Setting up libcpanel-json-xs-perl (4.25-1+b1) ... Setting up libdevel-size-perl (0.83-1+b2) ... Setting up unzip (6.0-26) ... Setting up libyaml-libyaml-perl (0.82+repack-1+b1) ... Setting up libtry-tiny-perl (0.30-1) ... Setting up liblzo2-2:amd64 (2.10-2) ... Setting up libtime-moment-perl (0.44-1+b3) ... Setting up libassuan0:amd64 (2.5.4-1) ... Setting up libconfig-tiny-perl (2.26-1) ... Setting up libsereal-encoder-perl (4.018+ds-1+b1) ... Setting up liblist-utilsby-perl (0.11-1) ... Setting up libsub-install-perl (0.928-1.1) ... Setting up libnumber-compare-perl (0.03-1.1) ... Setting up patchutils (0.4.2-1) ... Setting up libjson-maybexs-perl (1.004003-1) ... Setting up libclass-data-inheritable-perl (0.08-3) ... Setting up libfile-find-rule-perl (0.34-1) ... Setting up libipc-system-simple-perl (1.30-1) ... Setting up libnet-domain-tld-perl (1.75-1.1) ... Setting up lzip (1.22-3) ... Setting up diffstat (1.64-1) ... Setting up libvariable-magic-perl (0.62-1+b3) ... Setting up libb-hooks-op-check-perl (0.22-1+b3) ... Setting up liblist-moreutils-xs-perl (0.430-2) ... Setting up libparams-util-perl (1.102-1+b1) ... Setting up libtime-duration-perl (1.21-1) ... Setting up libtext-xslate-perl (3.5.8-1+b1) ... Setting up libsub-exporter-progressive-perl (0.001013-1) ... Setting up libcapture-tiny-perl (0.48-1) ... Setting up libtimedate-perl (2.3300-2) ... Setting up libsub-name-perl (0.26-1+b1) ... Setting up libdata-validate-domain-perl (0.10-1.1) ... Setting up libproc-processtable-perl (0.59-2+b1) ... Setting up libpath-tiny-perl (0.118-1) ... Setting up lzop (1.04-2) ... Setting up gpgconf (2.2.27-2) ... Setting up librole-tiny-perl (2.002004-1) ... Setting up libipc-run3-perl (0.048-2) ... Setting up libaliased-perl (0.34-1.1) ... Setting up libstrictures-perl (2.000006-1) ... Setting up libsub-quote-perl (2.006006-1) ... Setting up libdevel-stacktrace-perl (2.0400-1) ... Setting up libclass-xsaccessor-perl (1.19-3+b7) ... Setting up libexporter-tiny-perl (1.002002-1) ... Setting up libfont-ttf-perl (1.06-1.1) ... Setting up libtext-levenshteinxs-perl (0.03-4+b8) ... Setting up libperlio-gzip-perl (0.19-1+b7) ... Setting up libhtml-html5-entities-perl (0.004-1.1) ... Setting up libsereal-decoder-perl (4.018+ds-1+b1) ... Setting up libmarkdown2:amd64 (2.2.6-1) ... Setting up liburi-perl (5.08-1) ... Setting up gpg (2.2.27-2) ... Setting up libemail-address-xs-perl (1.04-1+b3) ... Setting up libfile-basedir-perl (0.08-1) ... Setting up liblist-moreutils-perl (0.430-2) ... Setting up libtype-tiny-perl (1.012002-1) ... Setting up libtext-markdown-discount-perl:amd64 (0.12-1+b1) ... Setting up libexception-class-perl (1.44-1) ... Setting up libdevel-callchecker-perl (0.008-1+b2) ... Setting up libdata-optlist-perl (0.110-1.1) ... Setting up libsub-exporter-perl (0.987-1) ... Setting up libiterator-perl (0.03+ds1-1.1) ... Setting up libiterator-util-perl (0.02+ds1-1.1) ... Setting up libparams-classify-perl (0.015-1+b3) ... Setting up libmodule-runtime-perl (0.016-1) ... Setting up libdata-dpath-perl (0.58-1) ... Setting up libmodule-implementation-perl (0.09-1.1) ... Setting up libpackage-stash-perl (0.39-1) ... Setting up libimport-into-perl (1.002005-1) ... Setting up libmoo-perl (2.004004-1) ... Setting up libmoox-aliases-perl (0.001006-1.1) ... Setting up libb-hooks-endofscope-perl (0.24-1.1) ... Setting up libnamespace-clean-perl (0.27-1) ... Setting up lintian (2.104.0) ... Setting up sbuild-build-depends-lintian-dummy:armel (0.invalid.0) ... Processing triggers for man-db (2.9.4-2) ... Not building database; man-db/auto-update is not 'true'. Processing triggers for libc-bin (2.31-12) ... I: Lintian run was successful. +------------------------------------------------------------------------------+ | Post Build | +------------------------------------------------------------------------------+ +------------------------------------------------------------------------------+ | Cleanup | +------------------------------------------------------------------------------+ Purging /<> Not cleaning session: cloned chroot in use +------------------------------------------------------------------------------+ | Summary | +------------------------------------------------------------------------------+ Build Architecture: amd64 Build Profiles: cross nocheck Build Type: any Build-Space: 155584 Build-Time: 150 Distribution: unstable Foreign Architectures: armel Host Architecture: armel Install-Time: 76 Job: wise_2.4.1-23 Lintian: pass Machine Architecture: amd64 Package: wise Package-Time: 240 Source-Version: 2.4.1-23 Space: 155584 Status: successful Version: 2.4.1-23 -------------------------------------------------------------------------------- Finished at 2021-06-05T17:30:25Z Build needed 00:04:00, 155584k disk space